Mouse anti-Human, Mouse BACH1 Monoclonal Antibody | anti-BACH1 antibody

BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (HRP)

Cat. Num. AAA6151381

• Gene Names: BACH1; BACH-1; BTBD24
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BACH1; Monoclonal Antibody; BACH1 (Transcription Regulator Protein BACH1; BTB and CNC Homolog 1; HA2303) (HRP); anti-BACH1 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B8
• Specificity: Recognizes human BACH1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 736

• Applicable Applications for anti-BACH1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa396-492 from human BACH1 (NP_996749) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB)

(BACH1 monoclonal antibody, Western Blot analysis of BACH1 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged BACH1 is ~0.03ng/ml as a capture antibody)

Related Product Information for anti-BACH1 antibody

ubiquitously expressed member of the Bach family of transcription factors. Although its predicted MW is 82kD, it runs anomalously at 110kD in SDS-PAGE. BACH1 forms noncovalent homodimers, and heterodimers with Maf oncoproteins and p53-related proteins. It apparently serves as an architectural component for gene regulatory protein complexes. Human BACH1 is 736 aa in length. It contains a protein-interaction BTB domain (aa 24-127), a DNA-binding motif (aa 562-577), and a Leu-zipper domain (aa 585-607). This molecule should not be confused with Bach1/Fancj/Brip1 helicase. There are two BACH1 splice variants with a 24 and 31aa substitution for aa593-736, respectively. Over aa 133-513, human BACH1 shares 75% aa identity with mouse BACH1.

Product Categories/Family for anti-BACH1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 45827690
• NCBI GeneID: 571
• NCBI Accession #: NP_996749
• NCBI GenBank Nucleotide #: NM_206866
• UniProt Accession #: O14867
• NCBI Official Full Name: transcription regulator protein BACH1
• NCBI Official Synonym Full Names: BTB domain and CNC homolog 1
• NCBI Official Symbol: BACH1
• NCBI Official Synonym Symbols: BACH-1; BTBD24
• NCBI Protein Information: transcription regulator protein BACH1
• UniProt Protein Name: Transcription regulator protein BACH1
• Protein Family: Transcription regulator protein
• UniProt Gene Name: BACH1
• UniProt Entry Name: BACH1_HUMAN

NCBI Description

This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, May 2009]

Uniprot Description

BACH1: a transcriptional regulator that acts as a repressor or activator. Binds, in-vitro, to NF-E2 binding sites on DNA. Plays an important role in coordinating transcription activation and repression by NF-E2. Belongs to the bZIP family, CNC subfamily.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: heme binding; transcription factor activity

Biological Process: G1/S-specific transcription in mitotic cell cycle; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; G2/M-specific transcription in mitotic cell cycle