Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human B3GNT6 Monoclonal Antibody | anti-B3GNT6 antibody

B3GNT6 (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, I-beta-1,3-N-acetylglucosaminyltransferase, iGnT, Poly-N-acetyllactosamine Extension Enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1, B3GNT1, MGC119334, MGC11933

Gene Names
B3GNT6; BGnT-6; B3Gn-T6; beta3Gn-T6; beta-1,3-Gn-T6
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
B3GNT6; Monoclonal Antibody; B3GNT6 (N-acetyllactosaminide beta-1; 3-N-acetylglucosaminyltransferase; I-beta-1; iGnT; Poly-N-acetyllactosamine Extension Enzyme; UDP-GlcNAc:betaGal beta-1; 3-N-acetylglucosaminyltransferase 1; B3GNT1; MGC119334; MGC11933; Anti -B3GNT6 (N-acetyllactosaminide beta-1; anti-B3GNT6 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2H6
Specificity
Recognizes human B3GNT6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC
Applicable Applications for anti-B3GNT6 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa316-416 from human B3GNT6 (NP_006867) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged B3GNT1 is 3ng/ml as a capture antibody.)

Related Product Information for anti-B3GNT6 antibody
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen.
Product Categories/Family for anti-B3GNT6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
42,748 Da
NCBI Official Full Name
B3GNT6 protein
NCBI Official Synonym Full Names
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase)
NCBI Official Symbol
B3GNT6
NCBI Official Synonym Symbols
BGnT-6; B3Gn-T6; beta3Gn-T6; beta-1,3-Gn-T6
NCBI Protein Information
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6; core 3 synthase; beta-1,3-N-acetylglucosaminyltransferase protein
UniProt Protein Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6
UniProt Gene Name
B3GNT6
UniProt Synonym Gene Names
BGnT-6; Beta-1,3-Gn-T6; Beta-1,3-N-acetylglucosaminyltransferase 6; Beta3Gn-T6
UniProt Entry Name
B3GN6_HUMAN

Uniprot Description

B3GNT6: Beta-1,3-N-acetylglucosaminyltransferase that synthesizes the core 3 structure of the O-glycan, an important precursor in the biosynthesis of mucin-type glycoproteins. Plays an important role in the synthesis of mucin-type O-glycans in digestive organs. Belongs to the glycosyltransferase 31 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; Membrane protein, integral; Glycan Metabolism - O-glycan biosynthesis; EC 2.4.1.-

Chromosomal Location of Human Ortholog: 11q13.4

Cellular Component: Golgi membrane; membrane; integral to membrane

Molecular Function: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity; galactosyltransferase activity

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; glycoprotein biosynthetic process; O-glycan processing; O-glycan processing, core 3; post-translational protein modification

Research Articles on B3GNT6

Similar Products

Product Notes

The B3GNT6 b3gnt6 (Catalog #AAA644468) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The B3GNT6 (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, I-beta-1,3-N-acetylglucosaminyltransferase, iGnT, Poly-N-acetyllactosamine Extension Enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1, B3GNT1, MGC119334, MGC11933 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's B3GNT6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the B3GNT6 b3gnt6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AYVVPWQDPW EPFYVAGGKV PTFDERFRQY GFNRISQACE LHVAGFDFEV LNEGFLVHKG FKEALKFHPQ KEAENQHNKI LYRQFKQELK AKYPNSPRRC. It is sometimes possible for the material contained within the vial of "B3GNT6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual