Western Blot (WB)
(AXL monoclonal antibody (M02), clone 6G1 Western Blot analysis of AXL expression in HeLa (Cat # L013V1).)
Mouse AXL Monoclonal Antibody | anti-AXL antibody
AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO) (HRP)
Gene Names
AXL; ARK; UFO; JTK11; Tyro7
Applications
Western Blot
Purity
Purified
Synonyms
AXL; Monoclonal Antibody; AXL (AXL Receptor Tyrosine Kinase; JTK11; UFO) (HRP); AXL Receptor Tyrosine Kinase; UFO; anti-AXL antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G1
Specificity
Recognizes AXL.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
894
Applicable Applications for anti-AXL antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AXL (AAH32229, 30aa-140aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(AXL monoclonal antibody (M02), clone 6G1 Western Blot analysis of AXL expression in HeLa (Cat # L013V1).)
Western Blot (WB)
(AXL monoclonal antibody (M02), clone 6G1 Western Blot analysis of AXL expression in HeLa (Cat # L013V1).)
Testing Data
(Detection limit for recombinant GST tagged AXL is approximately 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged AXL is approximately 1ng/ml as a capture antibody.)
Product Categories/Family for anti-AXL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
AXL receptor tyrosine kinase
NCBI Official Synonym Full Names
AXL receptor tyrosine kinase
NCBI Official Symbol
AXL
NCBI Official Synonym Symbols
ARK; UFO; JTK11; Tyro7
NCBI Protein Information
tyrosine-protein kinase receptor UFO
Protein Family
NCBI Description
The protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibronectin type-III motifs. It transduces signals from the extracellular matrix into the cytoplasm by binding to the vitamin K-dependent protein growth arrest-specific 6 (Gas6). This gene may be involved in several cellular functions including growth, migration, aggregation and anti-inflammation in multiple cell types. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]
Research Articles on AXL
Similar Products
Product Notes
The AXL (Catalog #AAA6181346) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AXL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AXL for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AXL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
