Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse AXIN2 Monoclonal Antibody | anti-AXIN2 antibody

AXIN2 (Axin 2, AXIL, DKFZp781B0869, MGC10366, MGC126582) (MaxLight 490)

Gene Names
AXIN2; AXIL; ODCRCS
Applications
Western Blot
Purity
Purified
Synonyms
AXIN2; Monoclonal Antibody; AXIN2 (Axin 2; AXIL; DKFZp781B0869; MGC10366; MGC126582) (MaxLight 490); Axin 2; MGC126582; anti-AXIN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B6
Specificity
Recognizes AXIN2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-AXIN2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AXIN2 (NP_004646, 611aa-710aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKP
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AXIN2 antibody
The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex of APC (adenomatous polyposis of the colon), beta-catenin, glycogen synthase kinase 3-beta, and conductin, which leads to the degradation of beta-catenin. Apparently, the deregulation of beta-catenin is an important event in the genesis of a number of malignancies. The AXIN2 gene has been mapped to 17q23-q24, a region that shows frequent loss of heterozygosity in breast cancer, neuroblastoma, and other tumors. Mutations in this gene have been associated with colorectal cancer with defective mismatch repair. [provided by RefSeq]
Product Categories/Family for anti-AXIN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
axin-2 isoform 1
NCBI Official Synonym Full Names
axin 2
NCBI Official Symbol
AXIN2
NCBI Official Synonym Symbols
AXIL; ODCRCS
NCBI Protein Information
axin-2
UniProt Protein Name
Axin-2
Protein Family
UniProt Gene Name
AXIN2
UniProt Synonym Gene Names
Axil
UniProt Entry Name
AXIN2_HUMAN

NCBI Description

The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex of APC (adenomatous polyposis of the colon), beta-catenin, glycogen synthase kinase 3-beta, and conductin, which leads to the degradation of beta-catenin. Apparently, the deregulation of beta-catenin is an important event in the genesis of a number of malignancies. The AXIN2 gene has been mapped to 17q23-q24, a region that shows frequent loss of heterozygosity in breast cancer, neuroblastoma, and other tumors. Mutations in this gene have been associated with colorectal cancer with defective mismatch repair. [provided by RefSeq, Jul 2008]

Uniprot Description

axin 2: is a negative regulator of the Wnt pathway, which is critical in stem cell signaling, morphogenesis, the mesenchymal-epithelial transition, and many cancers. Axin functions as a tumor suppressor. Probably facilitates the phosphorylation of beta-catenin and APC by GSK3B, leading to their ubiquitination and subsequent proteolysis. Is downregulated during progression of esophageal squamous cell carcinoma. Axin1/2 mediate cross-talk between TGF-beta and Wnt signaling pathways.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17q24.1

Cellular Component: microtubule cytoskeleton; nucleoplasm; Golgi apparatus; centrosome; cytoplasmic microtubule; postsynaptic density; cytoplasm; cytoplasmic membrane-bound vesicle; plasma membrane; cell cortex; cytosol; nucleus; beta-catenin destruction complex

Molecular Function: protein binding; enzyme binding; ubiquitin protein ligase binding; beta-catenin binding; protein kinase binding; GTPase activator activity

Biological Process: odontogenesis; negative regulation of cell proliferation; cell proliferation; intramembranous ossification; regulation of mismatch repair; mRNA stabilization; negative regulation of osteoblast differentiation; dorsal/ventral axis specification; positive regulation of protein amino acid phosphorylation; maintenance of DNA repeat elements; bone mineralization; positive regulation of GTPase activity

Disease: Oligodontia-colorectal Cancer Syndrome

Research Articles on AXIN2

Similar Products

Product Notes

The AXIN2 axin2 (Catalog #AAA6205293) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AXIN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AXIN2 axin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AXIN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.