Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ATP6V1D Monoclonal Antibody | anti-ATP6V1D antibody

ATP6V1D (V-type Proton ATPase Subunit D, V-ATPase Subunit D, V-ATPase 28kD Accessory Protein, Vacuolar Proton Pump Subunit D, ATP6M, VATD) (MaxLight 550)

Gene Names
ATP6V1D; VATD; VMA8; ATP6M
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP6V1D; Monoclonal Antibody; ATP6V1D (V-type Proton ATPase Subunit D; V-ATPase Subunit D; V-ATPase 28kD Accessory Protein; Vacuolar Proton Pump Subunit D; ATP6M; VATD) (MaxLight 550); anti-ATP6V1D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G4
Specificity
Recognizes human ATP6V1D.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-ATP6V1D antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa69-169 from human ATP6V1D (NP_057078) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRR
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-ATP6V1D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,263 Da
NCBI Official Full Name
V-type proton ATPase subunit D
NCBI Official Synonym Full Names
ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
NCBI Official Symbol
ATP6V1D
NCBI Official Synonym Symbols
VATD; VMA8; ATP6M
NCBI Protein Information
V-type proton ATPase subunit D; ATPase, H+ transporting lysosomal, member M; ATPase, H+ transporting, lysosomal (vacuolar proton pump); H(+)-transporting two-sector ATPase, subunit M; V-ATPase 28 kDa accessory protein; V-ATPase D subunit; V-ATPase subunit
UniProt Protein Name
V-type proton ATPase subunit D
UniProt Gene Name
ATP6V1D
UniProt Synonym Gene Names
ATP6M; VATD; V-ATPase subunit D
UniProt Entry Name
VATD_HUMAN

Uniprot Description

ATP6V1D: Subunit of the peripheral V1 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. Belongs to the V-ATPase D subunit family.

Protein type: EC 3.6.3.14; Hydrolase; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 14q23-q24.2

Cellular Component: centrosome; membrane; lysosomal membrane; cytosol; cilium

Molecular Function: protein binding; ATPase activity, coupled to transmembrane movement of substances

Biological Process: interaction with host; proton transport; cellular iron ion homeostasis; insulin receptor signaling pathway; cilium biogenesis; transferrin transport; transmembrane transport

Similar Products

Product Notes

The ATP6V1D atp6v1d (Catalog #AAA6210350) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP6V1D (V-type Proton ATPase Subunit D, V-ATPase Subunit D, V-ATPase 28kD Accessory Protein, Vacuolar Proton Pump Subunit D, ATP6M, VATD) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V1D can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP6V1D atp6v1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP6V1D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.