Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Mouse anti-Human ATP5J Monoclonal Antibody | anti-ATP5J antibody

ATP5J (ATP Synthase-coupling Factor 6, Mitochondrial, ATPase Subunit F6, ATP5A, ATPM) (AP)

Gene Names
ATP5J; F6; CF6; ATP5; ATPM; ATP5A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP5J; Monoclonal Antibody; ATP5J (ATP Synthase-coupling Factor 6; Mitochondrial; ATPase Subunit F6; ATP5A; ATPM) (AP); anti-ATP5J antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F10
Specificity
Recognizes human ATP5J.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ATP5J antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-108 from human ATP5J (AAH01178) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Testing Data

(Detection limit for recombinant GST tagged ATP5J is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ATP5J is ~1ng/ml as a capture antibody.)
Related Product Information for anti-ATP5J antibody
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 (ATP5J) is a multisubunit membrane-bound enzyme complex consisting of an F0 segment embedded in the membrane and an F1 segment attached to the F0. It is also a component of mitochondrial ATP synthase which is required for the interactions of the catalytic and proton-translocating segments. Human ATP5J shares 72% sequence identity with rat ATP5J.This import signal peptide is rich in basic amino acids, devoid of acidic amino acids, and amphiphilic, which allows it to be water-soluble yet capable of passage through the phospholipid membrane bilayers. Moreover, it is circulating and functions as an endogenous vasoconstrictor by inhibiting cytosolic phospholipase A2.
Product Categories/Family for anti-ATP5J antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
522
Molecular Weight
13,388 Da
NCBI Official Full Name
Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6, mRNA
NCBI Official Synonym Full Names
ATP synthase, H+ transporting, mitochondrial Fo complex subunit F6
NCBI Official Symbol
ATP5J
NCBI Official Synonym Symbols
F6; CF6; ATP5; ATPM; ATP5A
NCBI Protein Information
ATP synthase-coupling factor 6, mitochondrial

NCBI Description

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo complex has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the Fo complex. The F6 subunit is required for F1 and Fo interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has 1 or more pseudogenes. [provided by RefSeq, Feb 2016]

Research Articles on ATP5J

Similar Products

Product Notes

The ATP5J (Catalog #AAA6130130) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP5J (ATP Synthase-coupling Factor 6, Mitochondrial, ATPase Subunit F6, ATP5A, ATPM) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5J can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP5J for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP5J, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.