Mouse anti-Human ATP2B1 Monoclonal Antibody | anti-ATP2B1 antibody

ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1, PMCA1, Plasma Membrane Calcium ATPase Isoform 1, Plasma Membrane Calcium Pump Isoform 1, PMCA1) (Biotin)

Cat. Num. AAA6140730

• Gene Names: ATP2B1; PMCA1; PMCA1kb
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATP2B1; Monoclonal Antibody; ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1; PMCA1; Plasma Membrane Calcium ATPase Isoform 1; Plasma Membrane Calcium Pump Isoform 1; PMCA1) (Biotin); anti-ATP2B1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E2
• Specificity: Recognizes human ATP2B1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1220

• Applicable Applications for anti-ATP2B1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-97 from human ATP2B1 (NP_001673) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD).)

Testing Data

(Detection limit for recombinant GST tagged ATP2B1 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-ATP2B1 antibody

Calcium-transporting ATPase belongs to the cation transport ATPase (P-type) family and plays a critical role in intracellular calcium homeostasis. Mammalian Calcium-transporting ATPases are encoded by at least four separate genes with multiple isoforms produced by alternative splicing.

Product Categories/Family for anti-ATP2B1 antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 48255945
• NCBI GeneID: 490
• NCBI Accession #: NP_001673
• NCBI GenBank Nucleotide #: NM_001682
• UniProt Accession #: P20020
• NCBI Official Full Name: plasma membrane calcium-transporting ATPase 1 isoform 1b
• NCBI Official Synonym Full Names: ATPase plasma membrane Ca2+ transporting 1
• NCBI Official Symbol: ATP2B1
• NCBI Official Synonym Symbols: PMCA1; PMCA1kb
• NCBI Protein Information: plasma membrane calcium-transporting ATPase 1
• UniProt Protein Name: Plasma membrane calcium-transporting ATPase 1
• Protein Family: Plasma membrane calcium-transporting ATPase
• UniProt Gene Name: ATP2B1
• UniProt Synonym Gene Names: PMCA1
• UniProt Entry Name: AT2B1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 1. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]