Mouse anti-Human ATOH1 Monoclonal Antibody | anti-ATOH1 antibody

ATOH1 (Protein Atonal Homolog 1, Helix-loop-helix Protein hATH-1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, ATOH1, MATH1, HATH1) (FITC)

Cat. Num. AAA6146027

• Gene Names: ATOH1; ATH1; HATH1; MATH-1; bHLHa14
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATOH1; Monoclonal Antibody; ATOH1 (Protein Atonal Homolog 1; Helix-loop-helix Protein hATH-1; Class A Basic Helix-loop-helix Protein 14; bHLHa14; MATH1; HATH1) (FITC); anti-ATOH1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B12
• Specificity: Recognizes human ATOH1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ATOH1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa266-354 from human ATOH1 (NP_005163.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ATOH1 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-ATOH1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4885075
• NCBI GeneID: 474
• NCBI Accession #: NP_005163.1
• NCBI GenBank Nucleotide #: NM_005172
• UniProt Accession #: Q92858; Q14CT9
• Molecular Weight: 38,160 Da
• NCBI Official Full Name: protein atonal homolog 1
• NCBI Official Synonym Full Names: atonal homolog 1 (Drosophila)
• NCBI Official Symbol: ATOH1
• NCBI Official Synonym Symbols: ATH1; HATH1; MATH-1; bHLHa14
• NCBI Protein Information: protein atonal homolog 1; class A basic helix-loop-helix protein 14; helix-loop-helix protein hATH-1
• UniProt Protein Name: Protein atonal homolog 1
• Protein Family: Protein atonal
• UniProt Gene Name: ATOH1
• UniProt Synonym Gene Names: ATH1; BHLHA14; bHLHa14; hATH1
• UniProt Entry Name: ATOH1_HUMAN

NCBI Description

This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq, Jul 2008]

Uniprot Description

ATOH1: a conserved transcription factor that regulates secretory cell differentiation in colonic epithelium. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. May play a role in the differentiation of subsets of neural cells by activating E box- dependent transcription . Efficient DNA binding requires dimerization with another bHLH protein. Loss of ATOH1 expression in the colon of mice initiates colon cancer. ATOH1 has been silenced in most human colon cancers, and reactivation of this gene in cultured human colon cancer cells is anti-proliferative and induces apoptosis.

Protein type: DNA-binding; Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 4q22

Cellular Component: nucleus

Molecular Function: protein dimerization activity; chromatin DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; axon guidance; inner ear morphogenesis; central nervous system development; auditory receptor cell fate determination; neuron migration; positive regulation of transcription from RNA polymerase II promoter; positive regulation of auditory receptor cell differentiation; auditory receptor cell fate specification; cerebral cortex development; positive regulation of neuron differentiation; negative regulation of apoptosis