Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human, Rat Atlastin-1 Monoclonal Antibody | anti-ATL1 antibody

Atlastin-1 (ATL1, Brain-specific GTP-binding Protein, GTP-binding Protein 3, GBP3, GBP-3, hGBP3, Guanine Nucleotide-binding Protein 3, Spastic Paraplegia 3 Protein A, SPG3A) (FITC)

Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Atlastin-1; Monoclonal Antibody; Atlastin-1 (ATL1; Brain-specific GTP-binding Protein; GTP-binding Protein 3; GBP3; GBP-3; hGBP3; Guanine Nucleotide-binding Protein 3; Spastic Paraplegia 3 Protein A; SPG3A) (FITC); EC=3.6.5.-; AD-FSP; FSP1; HSN1D; SPG3; anti-ATL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B9
Specificity
Recognizes human SPG3A. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
558
Applicable Applications for anti-ATL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human SPG3A (NP_056999) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(SPG3A monoclonal antibody. Western Blot analysis of SPG3A expression in PC-12.)

Western Blot (WB) (SPG3A monoclonal antibody. Western Blot analysis of SPG3A expression in PC-12.)

Western Blot (WB)

(SPG3A monoclonal antibody Western Blot analysis of SPG3A expression in IMR-32.)

Western Blot (WB) (SPG3A monoclonal antibody Western Blot analysis of SPG3A expression in IMR-32.)

Testing Data

(Detection limit for recombinant GST tagged SPG3A is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SPG3A is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-ATL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
atlastin-1 isoform a
UniProt Protein Name
Atlastin-1
Protein Family
UniProt Gene Name
ATL1
UniProt Synonym Gene Names
GBP3; SPG3A; GBP-3; hGBP3

Uniprot Description

atlastin: GTPase tethering membranes through formation of trans- homooligomer and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis. May also regulate Golgi biogenesis. May regulate axonal development. Defects in ATL1 are the cause of spastic paraplegia autosomal dominant type 3 (SPG3); also known as Strumpell-Lorrain syndrome. Spastic paraplegia is a degenerative spinal cord disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Defects in ATL1 are the cause of hereditary sensory neuropathy type 1D (HSN1D). HSN1D is a disease characterized by adult-onset distal axonal sensory neuropathy leading to mutilating ulcerations as well as hyporeflexia. Some patients may show features suggesting upper neuron involvement. Belongs to the GBP family. Atlastin subfamily.

Protein type: EC 3.6.5.-; Membrane protein, integral; Membrane protein, multi-pass; Vesicle

Chromosomal Location of Human Ortholog: 14q22.1

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; Golgi apparatus; Golgi cis cisterna; integral to membrane

Molecular Function: GTP binding; GTPase activity; identical protein binding; protein binding

Biological Process: axonogenesis; endoplasmic reticulum organization and biogenesis; protein homooligomerization

Disease: Neuropathy, Hereditary Sensory, Type Id; Spastic Paraplegia 3, Autosomal Dominant

Similar Products

Product Notes

The ATL1 atl1 (Catalog #AAA6149859) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Atlastin-1 (ATL1, Brain-specific GTP-binding Protein, GTP-binding Protein 3, GBP3, GBP-3, hGBP3, Guanine Nucleotide-binding Protein 3, Spastic Paraplegia 3 Protein A, SPG3A) (FITC) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Atlastin-1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATL1 atl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Atlastin-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.