Testing Data
(Detection limit for recombinant GST tagged ASNS is ~0.3ng/ml as a capture antibody.)
Mouse anti-Human ASNS Monoclonal Antibody | anti-ASNS antibody
ASNS (Asparagine Synthetase [Glutamine-hydrolyzing], Cell Cycle Control Protein TS11, Glutamine-dependent Asparagine Synthetase, TS11) (PE)
Gene Names
ASNS; TS11; ASNSD
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASNS; Monoclonal Antibody; ASNS (Asparagine Synthetase [Glutamine-hydrolyzing]; Cell Cycle Control Protein TS11; Glutamine-dependent Asparagine Synthetase; TS11) (PE); anti-ASNS antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B3
Specificity
Recognizes human ASNS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ASNS antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa281-380 from human ASNS (AAH14621) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ASNS is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ASNS is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ASNS antibody
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase (NARS)is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases.
Product Categories/Family for anti-ASNS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
54,818 Da
NCBI Official Full Name
Homo sapiens asparagine synthetase, mRNA
NCBI Official Synonym Full Names
asparagine synthetase (glutamine-hydrolyzing)
NCBI Official Symbol
ASNS
NCBI Official Synonym Symbols
TS11; ASNSD
NCBI Protein Information
asparagine synthetase [glutamine-hydrolyzing]
Protein Family
NCBI Description
The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]
Research Articles on ASNS
Similar Products
Product Notes
The ASNS (Catalog #AAA6156615) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASNS (Asparagine Synthetase [Glutamine-hydrolyzing], Cell Cycle Control Protein TS11, Glutamine-dependent Asparagine Synthetase, TS11) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASNS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASNS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASNS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
