Mouse ASCL3 Monoclonal Antibody | anti-ASCL3 antibody

ASCL3 (Achaete-scute Complex Homolog 3 (Drosophila), HASH3, SGN1, bHLHa42) (MaxLight 405)

Gene Names

ASCL3; SGN1; HASH3; bHLHa42

Applications

Western Blot

Purity

Purified

Synonyms

ASCL3; Monoclonal Antibody; ASCL3 (Achaete-scute Complex Homolog 3 (Drosophila); HASH3; SGN1; bHLHa42) (MaxLight 405); Achaete-scute Complex Homolog 3 (Drosophila); bHLHa42; anti-ASCL3 antibody

Ordering
Cat. Num. AAA6194559 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

Mouse

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2F8

Specificity

Recognizes ASCL3.

Purity/Purification

Purified

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Applicable Applications for anti-ASCL3 antibody

FLISA, Western Blot (WB)

Application Notes

Applications are based on unconjugated antibody.

Immunogen

ASCL3 (NP_065697.1, 1aa-95aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFT

Conjugate

MaxLight405

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-ASCL3 antibody

Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]). [supplied by OMIM]

Product Categories/Family for anti-ASCL3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

NCBI GI #

10190680

NCBI GeneID

56676

NCBI Accession #

NP_065697.1

NCBI GenBank Nucleotide #

NM_020646.2

UniProt Accession #

Q9NQ33; Q8WYQ6

Molecular Weight

20,797 Da

NCBI Official Full Name

achaete-scute homolog 3

NCBI Official Synonym Full Names

achaete-scute family bHLH transcription factor 3

NCBI Official Symbol

ASCL3

NCBI Official Synonym Symbols

SGN1; HASH3; bHLHa42

NCBI Protein Information

achaete-scute homolog 3; achaete-scute complex homolog 3; bHLH transcriptional regulator Sgn-1; class A basic helix-loop-helix protein 42; bHLH transcription factor Sgn-1 (Salivary Glands 1)

UniProt Protein Name

Achaete-scute homolog 3

Protein Family

Achaete-scute

UniProt Gene Name

ASCL3

UniProt Synonym Gene Names

BHLHA42; HASH3; SGN1; ASH-3; hASH3; bHLHa42

UniProt Entry Name

ASCL3_HUMAN

NCBI Description

Uniprot Description

ASCL3: Transcriptional repressor. Inhibits myogenesis.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 11p15.3

Cellular Component: transcription factor complex; nucleus

Molecular Function: protein dimerization activity; DNA binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent

Similar Products

ASCL3 Antibody

Host: Rabbit

Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

Apps: Western Blot

Product Notes

The ASCL3 ascl3 (Catalog #AAA6194559) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ASCL3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASCL3 ascl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASCL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...