Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to ASB8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml].)

Mouse anti-Human ASB8 Monoclonal Antibody | anti-ASB8 antibody

ASB8 (Ankyrin Repeat and SOCS Box Protein 8, ASB-8, PP14212, FLJ21255, MGC5540) APC

Gene Names
ASB8; PP14212
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASB8; Monoclonal Antibody; ASB8 (Ankyrin Repeat and SOCS Box Protein 8; ASB-8; PP14212; FLJ21255; MGC5540) APC; anti-ASB8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H1
Specificity
Recognizes human ASB8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ASB8 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa179-289 from human ASB8 (NP_077000) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VINLIGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKNGTMPREVARDPQLCEKLTVLCSAPGTLKTLARYAVRRSLGLQYLPDAVKGLPLPASLKEYLLLLE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to ASB8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to ASB8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ASB8 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ASB8 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-ASB8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.0 kDa (311aa) confirmed by MALDI-TOF
NCBI Official Full Name
ankyrin repeat and SOCS box protein 8 isoform a
NCBI Official Synonym Full Names
ankyrin repeat and SOCS box containing 8
NCBI Official Symbol
ASB8
NCBI Official Synonym Symbols
PP14212
NCBI Protein Information
ankyrin repeat and SOCS box protein 8
UniProt Protein Name
Ankyrin repeat and SOCS box protein 8
UniProt Gene Name
ASB8
UniProt Synonym Gene Names
ASB-8
UniProt Entry Name
ASB8_HUMAN

Uniprot Description

ASB8: May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Chromosomal Location of Human Ortholog: 12q13.11

Cellular Component: cytoplasm

Biological Process: protein ubiquitination

Research Articles on ASB8

Similar Products

Product Notes

The ASB8 asb8 (Catalog #AAA6135394) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASB8 (Ankyrin Repeat and SOCS Box Protein 8, ASB-8, PP14212, FLJ21255, MGC5540) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASB8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASB8 asb8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASB8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.