Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (65.01kD).)

Mouse anti-Human ARR3 Monoclonal Antibody | anti-ARR3 antibody

ARR3 (Arrestin-C, Cone Arrestin, C-arrestin, cArr, Retinal Cone Arrestin-3, X-arrestin, ARRX, CAR) (FITC)

Gene Names
ARR3; ARRX; cArr; MYP26
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARR3; Monoclonal Antibody; ARR3 (Arrestin-C; Cone Arrestin; C-arrestin; cArr; Retinal Cone Arrestin-3; X-arrestin; ARRX; CAR) (FITC); anti-ARR3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Specificity
Recognizes human ARR3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ARR3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-359 from human ARR3 (AAH12096) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSYEAAR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (65.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (65.01kD).)

Testing Data

(Detection limit for recombinant GST tagged ARR3 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARR3 is 3ng/ml as a capture antibody.)
Related Product Information for anti-ARR3 antibody
Arrestins and G protein-coupled receptor kinases (GRKs) are key players in homologous desensitization of G protein-coupled receptors. Arrestin-C (Cone arresting/retinal cone arrestin 3) is likely to have a role in retina specific signal transduction, possibly binding to photoactivated phosphorylated red/green opsins. Arrestin-C is expressed in inner and outer segments, and the inner plexiform regions of the retina.
Product Categories/Family for anti-ARR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
407
Molecular Weight
39,667 Da
NCBI Official Full Name
Homo sapiens arrestin 3, retinal (X-arrestin), mRNA
NCBI Official Synonym Full Names
arrestin 3
NCBI Official Symbol
ARR3
NCBI Official Synonym Symbols
ARRX; cArr; MYP26
NCBI Protein Information
arrestin-C
Protein Family

NCBI Description

The protein encoded by this gene is a non-visual arrestin which binds to agonist-activated, phosphorylated G protein-coupled receptors. This binding uncouples the receptor from the heterotrimeric G protein, resulting in termination of the G protein-coupled receptor signaling. The encoded protein also is a part of the centrosome, interacting with gamma-tubulin to help regulate proper centrosome function. [provided by RefSeq, May 2016]

Research Articles on ARR3

Similar Products

Product Notes

The ARR3 (Catalog #AAA6145985) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARR3 (Arrestin-C, Cone Arrestin, C-arrestin, cArr, Retinal Cone Arrestin-3, X-arrestin, ARRX, CAR) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARR3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARR3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARR3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.