Western Blot (WB)
(Western Blot detection against Immunogen (37.99kD).)
Mouse anti-Human ARMCX1 Monoclonal Antibody | anti-Armcx1 antibody
ARMCX1 (ALEX1, Armadillo Repeat-containing X-linked Protein 1, ARM Protein Lost in Epithelial Cancers on Chromosome X 1, DKFZp686P06199)
Gene Names
Armcx1; ALEX1; 3010033I09Rik
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ARMCX1; Monoclonal Antibody; ARMCX1 (ALEX1; Armadillo Repeat-containing X-linked Protein 1; ARM Protein Lost in Epithelial Cancers on Chromosome X 1; DKFZp686P06199); Anti -ARMCX1 (ALEX1; anti-Armcx1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
6E10
Specificity
Recognizes human ARMCX1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTYISQVCDDT
Applicable Applications for anti-Armcx1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa188-296 from human ARMCX1 (NP_057692) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.99kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.99kD).)
Testing Data
(Detection limit for recombinant GST tagged ARMCX1 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ARMCX1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-Armcx1 antibody
ARMCX1 is a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and two Armadillo (arm) repeats. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members, including ALEX2 and ALEX3, on the X chromosome. [provided by RefSeq].
Product Categories/Family for anti-Armcx1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
50,643 Da
NCBI Official Full Name
Armcx1 protein
NCBI Official Synonym Full Names
armadillo repeat containing, X-linked 1
NCBI Official Symbol
Armcx1
NCBI Official Synonym Symbols
ALEX1; 3010033I09Rik
NCBI Protein Information
armadillo repeat-containing X-linked protein 1
UniProt Protein Name
Armadillo repeat-containing X-linked protein 1
Protein Family
UniProt Gene Name
Armcx1
UniProt Entry Name
ARMX1_MOUSE
Uniprot Description
ARMCX1:
Protein type: Membrane protein, integral
Cellular Component: membrane; integral to membrane
Similar Products
Product Notes
The Armcx1 armcx1 (Catalog #AAA6010663) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARMCX1 (ALEX1, Armadillo Repeat-containing X-linked Protein 1, ARM Protein Lost in Epithelial Cancers on Chromosome X 1, DKFZp686P06199) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARMCX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the Armcx1 armcx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RRGKFNFPYK IDDILSAPDL QKVLNILERT NDPFIQEVAL VTLGNNAAYS FNQNAIRELG GVPIIAKLIK TKDPIIREKT YNALNNLSVN AENQGKIKTY ISQVCDDT. It is sometimes possible for the material contained within the vial of "ARMCX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
