Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human ARMCX1 Monoclonal Antibody | anti-ARMCX1 antibody

ARMCX1 (ALEX1, Armadillo Repeat-containing X-linked Protein 1, ARM Protein Lost in Epithelial Cancers on Chromosome X 1, DKFZp686P06199) (HRP)

Gene Names
ARMCX1; ALEX1; GASP7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARMCX1; Monoclonal Antibody; ARMCX1 (ALEX1; Armadillo Repeat-containing X-linked Protein 1; ARM Protein Lost in Epithelial Cancers on Chromosome X 1; DKFZp686P06199) (HRP); anti-ARMCX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
6E10
Specificity
Recognizes human ARMCX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ARMCX1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa188-296 from human ARMCX1 (NP_057692) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAENQGKIKTYISQVCDDT
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Testing Data

(Detection limit for recombinant GST tagged ARMCX1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARMCX1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-ARMCX1 antibody
ARMCX1 is a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and two Armadillo (arm) repeats. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members, including ALEX2 and ALEX3, on the X chromosome. [provided by RefSeq].
Product Categories/Family for anti-ARMCX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
armadillo repeat-containing X-linked protein 1
NCBI Official Synonym Full Names
armadillo repeat containing X-linked 1
NCBI Official Symbol
ARMCX1
NCBI Official Synonym Symbols
ALEX1; GASP7
NCBI Protein Information
armadillo repeat-containing X-linked protein 1
UniProt Protein Name
Armadillo repeat-containing X-linked protein 1
UniProt Gene Name
ARMCX1
UniProt Synonym Gene Names
ALEX1; Protein ALEX1
UniProt Entry Name
ARMX1_HUMAN

NCBI Description

This gene encodes a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and two Armadillo (arm) repeats. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members, including ALEX2 and ALEX3, on the X chromosome. [provided by RefSeq, Jul 2008]

Uniprot Description

ARMCX1:

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq22.1

Cellular Component: integral to membrane

Research Articles on ARMCX1

Similar Products

Product Notes

The ARMCX1 armcx1 (Catalog #AAA6151279) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARMCX1 (ALEX1, Armadillo Repeat-containing X-linked Protein 1, ARM Protein Lost in Epithelial Cancers on Chromosome X 1, DKFZp686P06199) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARMCX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARMCX1 armcx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARMCX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.