Mouse anti-Human ARL6IP1 Monoclonal Antibody | anti-ARL6IP1 antibody
ARL6IP1 (ARL6IP, KIAA0069, ADP-ribosylation Factor-like Protein 6-interacting Protein 1) (FITC)
Gene Names
ARL6IP1; AIP1; ARMER; SPG61; ARL6IP
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARL6IP1; Monoclonal Antibody; ARL6IP1 (ARL6IP; KIAA0069; ADP-ribosylation Factor-like Protein 6-interacting Protein 1) (FITC); anti-ARL6IP1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F9
Specificity
Recognizes human ARL6IP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ARL6IP1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-204 from ARL6IP (AAH10281) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-ARL6IP1 antibody
ARL6IP1 may be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.
Product Categories/Family for anti-ARL6IP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
17,158 Da
NCBI Official Full Name
Homo sapiens ADP-ribosylation factor-like 6 interacting protein 1, mRNA
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 6 interacting protein 1
NCBI Official Symbol
ARL6IP1
NCBI Official Synonym Symbols
AIP1; ARMER; SPG61; ARL6IP
NCBI Protein Information
ADP-ribosylation factor-like protein 6-interacting protein 1
Protein Family
NCBI Description
This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]
Research Articles on ARL6IP1
Similar Products
Product Notes
The ARL6IP1 (Catalog #AAA6145969) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARL6IP1 (ARL6IP, KIAA0069, ADP-ribosylation Factor-like Protein 6-interacting Protein 1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARL6IP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARL6IP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARL6IP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
