Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Mouse ARID1B Monoclonal Antibody | anti-ARID1B antibody

ARID1B (AT Rich interactive Domain 1B (SWI1-like), 6A3-5, BAF250b, BRIGHT, DAN15, ELD/OSA1, KIAA1235, p250R) (APC)

Gene Names
ARID1B; CSS1; OSA2; 6A3-5; DAN15; MRD12; P250R; BRIGHT; BAF250B; ELD/OSA1
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
ARID1B; Monoclonal Antibody; ARID1B (AT Rich interactive Domain 1B (SWI1-like); 6A3-5; BAF250b; BRIGHT; DAN15; ELD/OSA1; KIAA1235; p250R) (APC); AT Rich interactive Domain 1B (SWI1-like); p250R; anti-ARID1B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F2
Specificity
Recognizes ARID1B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ARID1B antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ARID1B (NP_059989, 1364aa-1460aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Western Blot (WB)

(ARID1B monoclonal antibody (M02), clone 2F2 Western Blot analysis of ARID1B expression in Hela S3 NE.)

Western Blot (WB) (ARID1B monoclonal antibody (M02), clone 2F2 Western Blot analysis of ARID1B expression in Hela S3 NE.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-ARID1B antibody
Mouse monoclonal antibody raised against a partial recombinant ARID1B.
Product Categories/Family for anti-ARID1B antibody
References
1. Dynamics of expression of ARID1A and ARID1B subunits in mouse embryos and in cells during the cell cycle.Flores-Alcantar A, Gonzalez-Sandoval A, Escalante-Alcalde D, Lomeli H.Cell Tissue Res. 2011 Jun 7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
162,470 Da
NCBI Official Full Name
AT-rich interactive domain-containing protein 1B isoform 1
NCBI Official Synonym Full Names
AT-rich interaction domain 1B
NCBI Official Symbol
ARID1B
NCBI Official Synonym Symbols
CSS1; OSA2; 6A3-5; DAN15; MRD12; P250R; BRIGHT; BAF250B; ELD/OSA1
NCBI Protein Information
AT-rich interactive domain-containing protein 1B
UniProt Protein Name
AT-rich interactive domain-containing protein 1B
UniProt Gene Name
ARID1B
UniProt Synonym Gene Names
BAF250B; DAN15; KIAA1235; OSA2; ARID domain-containing protein 1B; BAF250B; hOsa2
UniProt Entry Name
ARI1B_HUMAN

NCBI Description

This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]

Uniprot Description

ARID1B: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Binds DNA non-specifically. Defects in ARID1B are the cause of mental retardation autosomal dominant type 12 (MRD12). A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRD12 patients present with moderate to severe psychomotor retardation, and most show evidence of muscular hypotonia. In many patients, expressive speech is more severely affected than receptive function. Additional common findings include short stature, abnormal head shape and low-set, posteriorly rotated, and abnormally shaped ears, downslanting palpebral fissures, a bulbous nasal tip, a thin upper lip, minor teeth anomalies, and brachydactyly or single palmar creases. Autistic features are uncommon. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; DNA-binding

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: nucleoplasm; SWI/SNF complex; cytoplasm

Molecular Function: protein binding; DNA binding; transcription coactivator activity

Biological Process: nervous system development; transcription, DNA-dependent; chromatin-mediated maintenance of transcription

Disease: Mental Retardation, Autosomal Dominant 12

Research Articles on ARID1B

Similar Products

Product Notes

The ARID1B arid1b (Catalog #AAA6167207) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ARID1B can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARID1B arid1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARID1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.