Mouse anti-Human ARHGEF11 Monoclonal Antibody | anti-ARHGEF11 antibody

ARHGEF11 (Rho Guanine Nucleotide Exchange Factor 11, PDZ-RhoGEF, KIAA0380, DKFZp667F1223, GTRAP48) (HRP)

Cat. Num. AAA6151264

• Gene Names: ARHGEF11; GTRAP48; PDZ-RHOGEF
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARHGEF11; Monoclonal Antibody; ARHGEF11 (Rho Guanine Nucleotide Exchange Factor 11; PDZ-RhoGEF; KIAA0380; DKFZp667F1223; GTRAP48) (HRP); anti-ARHGEF11 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F4
• Specificity: Recognizes human ARHGEF11.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 6904

• Applicable Applications for anti-ARHGEF11 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa651-750 from ARHGEF11 (AAH57394) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(ARHGEF11 monoclonal antibody Western Blot analysis of ARHGEF11 expression in human colon.)

Testing Data

(Detection limit for recombinant GST tagged ARHGEF11 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-ARHGEF11 antibody

May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13.

Product Categories/Family for anti-ARHGEF11 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1433462565
• NCBI GeneID: 9826
• NCBI Official Full Name: Homo sapiens Rho guanine nucleotide exchange factor (GEF) 11, mRNA
• NCBI Official Synonym Full Names: Rho guanine nucleotide exchange factor 11
• NCBI Official Symbol: ARHGEF11
• NCBI Official Synonym Symbols: GTRAP48; PDZ-RHOGEF
• NCBI Protein Information: rho guanine nucleotide exchange factor 11
• Protein Family: Rho guanine nucleotide exchange factor

NCBI Description

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]