Testing Data
(Detection limit for recombinant GST tagged ARHGEF1 is approximately 1ng/ml as a capture antibody.)
Mouse ARHGEF1 Monoclonal Antibody | anti-ARHGEF1 antibody
ARHGEF1 (Rho Guanine Nucleotide Exchange Factor (GEF) 1, GEF1, LBCL2, LSC, P115-RHOGEF, SUB1.5) (AP)
Gene Names
ARHGEF1; LSC; GEF1; IMD62; LBCL2; SUB1.5; P115-RHOGEF
Applications
Western Blot
Purity
Purified
Synonyms
ARHGEF1; Monoclonal Antibody; ARHGEF1 (Rho Guanine Nucleotide Exchange Factor (GEF) 1; GEF1; LBCL2; LSC; P115-RHOGEF; SUB1.5) (AP); Rho Guanine Nucleotide Exchange Factor (GEF) 1; SUB1.5; anti-ARHGEF1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D2
Specificity
Recognizes ARHGEF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
927
Applicable Applications for anti-ARHGEF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ARHGEF1 (AAH34013.2, 830aa-927aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ARHGEF1 is approximately 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ARHGEF1 is approximately 1ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of ARHGEF1 expression in transfected 293T cell line by ARHGEF1 monoclonal antibody (M02), clone 2D2.Lane 1: ARHGEF1 transfected lysate (Predicted MW: 102.4 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ARHGEF1 expression in transfected 293T cell line by ARHGEF1 monoclonal antibody (M02), clone 2D2.Lane 1: ARHGEF1 transfected lysate (Predicted MW: 102.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-ARHGEF1 antibody
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq]
Product Categories/Family for anti-ARHGEF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Rho guanine nucleotide exchange factor (GEF) 1
NCBI Official Synonym Full Names
Rho guanine nucleotide exchange factor 1
NCBI Official Symbol
ARHGEF1
NCBI Official Synonym Symbols
LSC; GEF1; IMD62; LBCL2; SUB1.5; P115-RHOGEF
NCBI Protein Information
rho guanine nucleotide exchange factor 1
Protein Family
NCBI Description
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2008]
Research Articles on ARHGEF1
Similar Products
Product Notes
The ARHGEF1 (Catalog #AAA6162840) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ARHGEF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARHGEF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARHGEF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
