Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Mouse anti-Human ARHGAP4 Monoclonal Antibody | anti-ARHGAP4 antibody

ARHGAP4 (ARHGAP 4, C1, KIAA0131, p115, Rho-GAP Hematopoietic Protein C1, RGC1, Rho GTPase-activating Protein 4, RhoGAP 4, RhoGAP4) (Biotin)

Gene Names
ARHGAP4; C1; RGC1; p115; SrGAP4; RhoGAP4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARHGAP4; Monoclonal Antibody; ARHGAP4 (ARHGAP 4; C1; KIAA0131; p115; Rho-GAP Hematopoietic Protein C1; RGC1; Rho GTPase-activating Protein 4; RhoGAP 4; RhoGAP4) (Biotin); anti-ARHGAP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F7
Specificity
Recognizes human ARHGAP4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
3387
Applicable Applications for anti-ARHGAP4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa881-986 from human ARHGAP4 (AAH52303) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB)

(ARHGAP4 monoclonal antibody Western Blot analysis of ARHGAP4 expression in K-562.)

Western Blot (WB) (ARHGAP4 monoclonal antibody Western Blot analysis of ARHGAP4 expression in K-562.)
Related Product Information for anti-ARHGAP4 antibody
ARHGAP4 (Rho GTPase-activating protein 4) has an inhibitory effect on stress fiber organization. It is a member of the group of signaling proteins involved in regulation of the small GTP-binding proteins of the RAS superfamily.
Product Categories/Family for anti-ARHGAP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
393
NCBI Official Full Name
Homo sapiens Rho GTPase activating protein 4, mRNA
NCBI Official Synonym Full Names
Rho GTPase activating protein 4
NCBI Official Symbol
ARHGAP4
NCBI Official Synonym Symbols
C1; RGC1; p115; SrGAP4; RhoGAP4
NCBI Protein Information
rho GTPase-activating protein 4

NCBI Description

This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Research Articles on ARHGAP4

Similar Products

Product Notes

The ARHGAP4 (Catalog #AAA6140652) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARHGAP4 (ARHGAP 4, C1, KIAA0131, p115, Rho-GAP Hematopoietic Protein C1, RGC1, Rho GTPase-activating Protein 4, RhoGAP 4, RhoGAP4) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGAP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARHGAP4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARHGAP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.