Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ARL14 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human ARF7 Monoclonal Antibody | anti-NPH4 antibody

ARF7 (ADP-ribosylation Factor-like Protein 14, ADP-ribosylation Factor 7, ARL14, FLJ22595)

Gene Names
NPH4; ARF7; AUXIN RESPONSE FACTOR 7; AUXIN-REGULATED TRANSCRIPTIONAL ACTIVATOR 7; AUXIN-RESPONSIVE TRANSCRIPTIONAL ACTIVATOR 7; BIP; BIPOSTO; IAA21; IAA23; IAA25; indole-3-acetic acid inducible 21; indole-3-acetic acid inducible 23; indole-3-acetic acid inducib
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ARF7; Monoclonal Antibody; ARF7 (ADP-ribosylation Factor-like Protein 14; ADP-ribosylation Factor 7; ARL14; FLJ22595); Anti -ARF7 (ADP-ribosylation Factor-like Protein 14; anti-NPH4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1 lambda
Clone Number
2C8
Specificity
Recognizes human ARF7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN
Applicable Applications for anti-NPH4 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Full length recombinant corresponding to aa1-193 from human ARF7 (AAH34354) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ARL14 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARL14 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-NPH4 antibody
GTPase that recruits MYO1E to MHC class II-containing vesicles via the effector protein ARL14EP and hence controls the movement of these vesicles along the actin cytoskeleton in dendritic cells.
Product Categories/Family for anti-NPH4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128,886 Da
NCBI Official Full Name
auxin-regulated transcriptional activator NPH4
NCBI Official Symbol
NPH4
NCBI Official Synonym Symbols
ARF7; AUXIN RESPONSE FACTOR 7; AUXIN-REGULATED TRANSCRIPTIONAL ACTIVATOR 7; AUXIN-RESPONSIVE TRANSCRIPTIONAL ACTIVATOR 7; BIP; BIPOSTO; IAA21; IAA23; IAA25; indole-3-acetic acid inducible 21; indole-3-acetic acid inducible 23; indole-3-acetic acid inducib
NCBI Protein Information
auxin-regulated transcriptional activator NPH4
UniProt Protein Name
Auxin response factor 7
UniProt Gene Name
ARF7
UniProt Synonym Gene Names
BIP; IAA21; IAA23; IAA25; NPH4; TIR5
UniProt Entry Name
ARFG_ARATH

Uniprot Description

Function: Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional activator. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Required for differential growth responses of aerial tissues. Involved in ethylene responses. Regulates lateral root formation through direct regulation of LBD16 and/or LBD29. Functionally redundant with ARF19. Mediates embryo axis formation and vascular tissues differentiation. Functionally redundant with ARF7. Ref.11 Ref.13 Ref.14 Ref.15

Subunit structure: Homodimers and heterodimers. Interacts with the auxin-responsive proteins IAA1, IAA12 (BODENLOS), IAA19 and ARF5. Ref.10 Ref.12 Ref.15

Subcellular location: Nucleus.

Tissue specificity: Expressed in the whole plant. Ref.10

Domain: Interactions between auxin response factors (ARFs) and Aux/IAA proteins occur through their C-terminal dimerization domains III and IV.

Sequence similarities: Belongs to the ARF family.Contains 1 Aux/IAA-ARF domain.Contains 1 TF-B3 DNA-binding domain.

Sequence caution: The sequence AAB92474.1 differs from that shown. Reason: Frameshift at several positions.

Research Articles on NPH4

Similar Products

Product Notes

The NPH4 arf7 (Catalog #AAA6006413) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARF7 (ADP-ribosylation Factor-like Protein 14, ADP-ribosylation Factor 7, ARL14, FLJ22595) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARF7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the NPH4 arf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSLGSKNPQ TKQAQVLLLG LDSAGKSTLL YKLKLAKDIT TIPTIGFNVE MIELERNFSL TVWDVGGQEK MRTVWGCYCE NTDGLVYVVD STDKQRLEES QRQFEHILKN EHIKNVPVVL LANKQDMPGA LTAEDITRMF KVKKLCSDRN WYVQPCCALT GEGLAQGFRK LTGFVKSHMK SRGDTLAFFK QN. It is sometimes possible for the material contained within the vial of "ARF7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.