Mouse ARF1 Monoclonal Antibody | anti-ARF1 antibody

ARF1 (ADP-Ribosylation Factor 1) (APC)

Cat. Num. AAA6170064

• Gene Names: ARF1; PVNH8
• Applications: ELISA, Immunofluorescence
• Purity: Purified
• Synonyms: ARF1; Monoclonal Antibody; ARF1 (ADP-Ribosylation Factor 1) (APC); ADP-Ribosylation Factor 1; anti-ARF1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G6
• Specificity: Recognizes ARF1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 181

• Applicable Applications for anti-ARF1 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ARF1 (AAH11358.1, 1aa-181aa) full-length recombinant protein with GST tag.
• Immunogen Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDVVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARF1 on HeLa cell. [antibody concentration 20 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARF1 on HeLa cell. [antibody concentration 20 ug/ml])

Related Product Information for anti-ARF1 antibody

ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-ARF1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15030201
• NCBI GeneID: 375
• NCBI Official Full Name: ADP-ribosylation factor 1
• NCBI Official Synonym Full Names: ADP ribosylation factor 1
• NCBI Official Symbol: ARF1
• NCBI Official Synonym Symbols: PVNH8
• NCBI Protein Information: ADP-ribosylation factor 1
• Protein Family: Auxin response factor

NCBI Description

ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]