Mouse anti-Human ARAF Monoclonal Antibody | anti-ARAF antibody

ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog, OTTHUMP00000023212, Oncogene ARAF1, Ras-Binding Protein DA-Raf, V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1, A-RAF, ARAF1, PKS2, RAFA1) (MaxLight 490)

Cat. Num. AAA6204746

• Gene Names: ARAF; PKS2; A-RAF; ARAF1; RAFA1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: ARAF; Monoclonal Antibody; ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog; OTTHUMP00000023212; Oncogene ARAF1; Ras-Binding Protein DA-Raf; V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1; A-RAF; ARAF1; PKS2; RAFA1) (MaxLight 490); anti-ARAF antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6H6
• Specificity: Recognizes human ARAF.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-ARAF antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant protein corresponding to aa151-250 from human ARAF with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-ARAF antibody

Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May also regulate the TOR signaling cascade.

Product Categories/Family for anti-ARAF antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4502193
• NCBI GeneID: 369
• NCBI Accession #: NP_001645
• NCBI GenBank Nucleotide #: NM_001654
• UniProt Accession #: P10398
• Molecular Weight: 67kDa
• NCBI Official Full Name: serine/threonine-protein kinase A-Raf isoform 1
• NCBI Official Synonym Full Names: A-Raf proto-oncogene, serine/threonine kinase
• NCBI Official Symbol: ARAF
• NCBI Official Synonym Symbols: PKS2; A-RAF; ARAF1; RAFA1
• NCBI Protein Information: serine/threonine-protein kinase A-Raf
• UniProt Protein Name: Serine/threonine-protein kinase A-Raf
• Protein Family: ABC transporter L-arabinose-binding periplasmic protein
• UniProt Gene Name: ARAF
• UniProt Synonym Gene Names: ARAF1; PKS; PKS2
• UniProt Entry Name: ARAF_HUMAN

NCBI Description

This proto-oncogene belongs to the RAF subfamily of the Ser/Thr protein kinase family, and maybe involved in cell growth and development. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2012]

Uniprot Description

ARAF: a tyrosine kinase-like kinase of the RAF family. Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron. Frequently mutated in thyroid cancers, skin melanomas and at lower frequency in a wide range of human cancers. An activating mutation, mimicking phosphorylation of the activation loop, is seen in 60% of malignant melanoma samples. Raf mutations are generally exclusive to Ras activating mutations. Activating mutations are also seen in ~10% of colorectal cancers, in lung cancers and gliomas, and at a lower rate in several other tumors. Inactivating mutations are also seen and may result in activation of c-Raf and Erk. Mutations in B-Raf, MEK1 and MEK2 also associated with cardiofaciocutaneous syndrome, displaying morphological, cardiac and mental defects. Approved Inhibitor: Nexavar/Sorafenib.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); Oncoprotein; Kinase, protein; EC 2.7.11.1; TKL group; RAF family

Chromosomal Location of Human Ortholog: Xp11.4-p11.2

Molecular Function: protein serine/threonine kinase activity; protein binding; metal ion binding; receptor signaling protein activity; ATP binding; protein kinase activity

Biological Process: regulation of proteasomal ubiquitin-dependent protein catabolic process; protein modification process; protein amino acid phosphorylation; positive regulation of peptidyl-serine phosphorylation; negative regulation of apoptosis; regulation of TOR signaling pathway