Mouse anti-Human APPBP2 Monoclonal Antibody | anti-APPBP2 antibody

APPBP2 (KIAA0228, PAT1, Amyloid Protein-binding Protein 2, Amyloid beta Precursor Protein-binding Protein 2, Protein Interacting with APP Tail 1) APC

Cat. Num. AAA6135340

• Gene Names: APPBP2; PAT1; APP-BP2; HS.84084
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: APPBP2; Monoclonal Antibody; APPBP2 (KIAA0228; PAT1; Amyloid Protein-binding Protein 2; Amyloid beta Precursor Protein-binding Protein 2; Protein Interacting with APP Tail 1) APC; anti-APPBP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C2
• Specificity: Recognizes human APPBP2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-APPBP2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa486-585 from APPBP2 (NP_006371) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of APPBP2 expression in transfected 293T cell line by APPBP2 monoclonal antibody. Lane 1: APPBP2 transfected lysate (66.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged APPBP2 is 1ng/ml as a capture antibody.)

Related Product Information for anti-APPBP2 antibody

The protein encoded by this gene interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. This gene has been found to be highly expressed in breast cancer. Multiple polyadenylation sites have been found for this gene.

Product Categories/Family for anti-APPBP2 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18104962
• NCBI GeneID: 10513
• NCBI Accession #: NP_006371
• NCBI GenBank Nucleotide #: NM_006380
• UniProt Accession #: Q92624; O95095; Q8WVC9; A8K862
• Molecular Weight: Predicted: 64 kDa; ; Observed: 57 kDa
• NCBI Official Full Name: amyloid protein-binding protein 2 isoform 1
• NCBI Official Synonym Full Names: amyloid beta precursor protein (cytoplasmic tail) binding protein 2
• NCBI Official Symbol: APPBP2
• NCBI Official Synonym Symbols: PAT1; APP-BP2; HS.84084
• NCBI Protein Information: amyloid protein-binding protein 2; protein interacting with APP tail 1
• UniProt Protein Name: Amyloid protein-binding protein 2
• Protein Family: Amyloid protein-binding protein
• UniProt Gene Name: APPBP2
• UniProt Synonym Gene Names: KIAA0228; PAT1; APP-BP2
• UniProt Entry Name: APBP2_HUMAN

NCBI Description

The protein encoded by this gene interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. The encoded protein may be involved in regulating cell death. This gene has been found to be highly expressed in breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

APPBP2: May play a role in intracellular protein transport. May be involved in the translocation of APP along microtubules toward the cell surface.

Protein type: Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 17q23.2

Cellular Component: microtubule; microtubule associated complex; cytoplasmic vesicle membrane; cytoplasm; nucleus

Molecular Function: protein binding; microtubule motor activity

Biological Process: intracellular protein transport; intracellular transport; metabolic process