Mouse anti-Human APOL3 Monoclonal Antibody | anti-APOL3 antibody

APOL3 (Apolipoprotein L3, Apolipoprotein L-III, ApoL-III, TNF-inducible Protein CG12-1, CG12_1) (PE)

Cat. Num. AAA6156547

• Gene Names: APOL3; CG121; CG12_1; APOLIII; apoL-III
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: APOL3; Monoclonal Antibody; APOL3 (Apolipoprotein L3; Apolipoprotein L-III; ApoL-III; TNF-inducible Protein CG12-1; CG12_1) (PE); anti-APOL3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E5
• Specificity: Recognizes human APOL3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-APOL3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa240-337 from human APOL3 (NP_663615) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB)

(APOL3 monoclonal antibody, Western Blot analysis of APOL3 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged APOL3 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-APOL3 antibody

APOL3 may be involved in cytoplasmic lipid transport or allow the binding of lipids to organelles. It is widely expressed; the highest levels are in prostate, lung and placenta; also detected in kidney, bone marrow, spleen, thymus, spinal cord, adrenal gland, salivary gland, trachea and mammary gland; levels are low in brain, heart, fetal liver, pancreas and testis. There are three named isoforms.

Product Categories/Family for anti-APOL3 antibody

Antibodies; Lipoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 22035646
• NCBI GeneID: 80833
• NCBI Accession #: NP_663615
• NCBI GenBank Nucleotide #: NM_145640
• UniProt Accession #: O95236
• Molecular Weight: 44kDa
• NCBI Official Full Name: apolipoprotein L3 isoform 1
• NCBI Official Synonym Full Names: apolipoprotein L3
• NCBI Official Symbol: APOL3
• NCBI Official Synonym Symbols: CG121; CG12_1; APOLIII; apoL-III
• NCBI Protein Information: apolipoprotein L3
• UniProt Protein Name: Apolipoprotein L3
• Protein Family: Apolipoprotein
• UniProt Gene Name: APOL3
• UniProt Entry Name: APOL3_HUMAN

NCBI Description

This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]