Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of APOBEC3C transfected lysate using APOBEC3C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOBEC3C rabbit polyclonal antibody.)

Mouse anti-Human APOBEC3C Monoclonal Antibody | anti-APOBEC3C antibody

APOBEC3C (APOBEC1L, PBI, DNA dC->dU-editing Enzyme APOBEC-3C, A3C, APOBEC1-like, Phorbolin I) (HRP)

Gene Names
APOBEC3C; A3C; PBI; ARP5; ARDC2; ARDC4; APOBEC1L; bK150C2.3
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOBEC3C; Monoclonal Antibody; APOBEC3C (APOBEC1L; PBI; DNA dC->dU-editing Enzyme APOBEC-3C; A3C; APOBEC1-like; Phorbolin I) (HRP); anti-APOBEC3C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E6
Specificity
Recognizes human APOBEC3C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-APOBEC3C antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa91-191 from human APOBEC3C (NP_055323) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of APOBEC3C transfected lysate using APOBEC3C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOBEC3C rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of APOBEC3C transfected lysate using APOBEC3C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOBEC3C rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged APOBEC3C is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged APOBEC3C is 1ng/ml as a capture antibody.)
Related Product Information for anti-APOBEC3C antibody
DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single-or double-stranded RNA. Exhibits antiviral activity against simian immunodeficiency virus (SIV), hepatitis B virus (HBV), herpes simplex virus 1 (HHV-1) and Epstein-Barr virus (EBV) and may inhibit the mobility of LTR and non-LTR retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
Product Categories/Family for anti-APOBEC3C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,826 Da
NCBI Official Full Name
DNA dC->dU-editing enzyme APOBEC-3C
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C
NCBI Official Symbol
APOBEC3C
NCBI Official Synonym Symbols
A3C; PBI; ARP5; ARDC2; ARDC4; APOBEC1L; bK150C2.3
NCBI Protein Information
DNA dC->dU-editing enzyme APOBEC-3C; apolipoprotein B editing enzyme catalytic polypeptide-like 3C; phorbolin I; probable DNA dC->dU-editing enzyme APOBEC-3C
UniProt Protein Name
DNA dC->dU-editing enzyme APOBEC-3C
Protein Family
UniProt Gene Name
APOBEC3C
UniProt Synonym Gene Names
APOBEC1L; PBI; A3C
UniProt Entry Name
ABC3C_HUMAN

Similar Products

Product Notes

The APOBEC3C apobec3c (Catalog #AAA6151238) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APOBEC3C (APOBEC1L, PBI, DNA dC->dU-editing Enzyme APOBEC-3C, A3C, APOBEC1-like, Phorbolin I) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC3C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOBEC3C apobec3c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOBEC3C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.