Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD) using MBS6011388.)

Mouse anti-Human APOB48R Monoclonal Antibody | anti-APOB48R antibody

APOB48R (Apolipoprotein B Receptor, Apolipoprotein B-100 Receptor, Apolipoprotein B-48 Receptor, Apolipoprotein B48 Receptor, apoB-48R, APOBR) (MaxLight 405)

Gene Names
APOBR; APOB48R; APOB100R
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOB48R; Monoclonal Antibody; APOB48R (Apolipoprotein B Receptor; Apolipoprotein B-100 Receptor; Apolipoprotein B-48 Receptor; Apolipoprotein B48 Receptor; apoB-48R; APOBR) (MaxLight 405); anti-APOB48R antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Specificity
Recognizes human APOB48R.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-APOB48R antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa71-170 from human APOB48R with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD) using MBS6011388.)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD) using MBS6011388.)

Immunohistochemistry (IHC)

(Immunoperoxidase of MBS6011388 (1.5ug/ml) on formalin-fixed paraffin-embedded human prostate.)

Immunohistochemistry (IHC) (Immunoperoxidase of MBS6011388 (1.5ug/ml) on formalin-fixed paraffin-embedded human prostate.)
Product Categories/Family for anti-APOB48R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114,874 Da
NCBI Official Full Name
apolipoprotein B receptor
NCBI Official Synonym Full Names
apolipoprotein B receptor
NCBI Official Symbol
APOBR
NCBI Official Synonym Symbols
APOB48R; APOB100R
NCBI Protein Information
apolipoprotein B receptor; apoB-48R; apolipoprotein B48 receptor; apolipoprotein B-48 receptor; apolipoprotein B100 receptor; apolipoprotein B-100 receptor
UniProt Protein Name
Apolipoprotein B receptor
UniProt Gene Name
APOBR
UniProt Synonym Gene Names
APOB48R; Apolipoprotein B48 receptor; apoB-48R
UniProt Entry Name
APOBR_HUMAN

NCBI Description

Apolipoprotein B48 receptor is a macrophage receptor that binds to the apolipoprotein B48 of dietary triglyceride (TG)-rich lipoproteins. This receptor may provide essential lipids, lipid-soluble vitamins and other nutrients to reticuloendothelial cells. If overwhelmed with elevated plasma triglyceride, the apolipoprotein B48 receptor may contribute to foam cell formation, endothelial dysfunction, and atherothrombogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

APOB48R: Macrophage receptor that binds to the apolipoprotein B48 (APOB) of dietary triglyceride (TG)-rich lipoproteins (TRL) or to a like domain of APOB in hypertriglyceridemic very low density lipoprotein (HTG-VLDL). Binds and internalizes TRL when out of the context of the macrophage. May provide essential lipids to reticuloendothelial cells. Could also be involved in foam cell formation with elevated TRL and remnant lipoprotein (RLP). Mediates the rapid high-affinity uptake of chylomicrons (CM), HTG- VLDL, and trypsinized (tryp) VLDL devoid of APOE in vitro in macrophages. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.

Chromosomal Location of Human Ortholog: 16p11

Cellular Component: chylomicron; membrane; plasma membrane

Molecular Function: very-low-density lipoprotein receptor activity

Biological Process: receptor-mediated endocytosis; cholesterol metabolic process; triacylglycerol metabolic process; lipid transport

Research Articles on APOB48R

Similar Products

Product Notes

The APOB48R apobr (Catalog #AAA6188888) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APOB48R (Apolipoprotein B Receptor, Apolipoprotein B-100 Receptor, Apolipoprotein B-48 Receptor, Apolipoprotein B48 Receptor, apoB-48R, APOBR) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOB48R can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOB48R apobr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOB48R, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.