Western Blot (WB)
(Western Blot detection against Immunogen (38.54kD).)
Mouse anti-Human APEG1 Monoclonal Antibody | anti-SPEG antibody
APEG1 (Striated Muscle Preferentially Expressed Protein Kinase, Aortic Preferentially Expressed Protein 1, APEG-1, SPEG, KIAA1297)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
APEG1; Monoclonal Antibody; APEG1 (Striated Muscle Preferentially Expressed Protein Kinase; Aortic Preferentially Expressed Protein 1; APEG-1; SPEG; KIAA1297); Anti -APEG1 (Striated Muscle Preferentially Expressed Protein Kinase; anti-SPEG antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C2-2C7
Specificity
Recognizes human APEG1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
Applicable Applications for anti-SPEG antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-113 from APEG1 (AAH06346) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.54kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.54kD).)
Testing Data
(Detection limit for recombinant GST tagged APEG1 is ~3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged APEG1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-SPEG antibody
Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.
Product Categories/Family for anti-SPEG antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
354,289 Da
NCBI Official Full Name
APEG1
UniProt Protein Name
Striated muscle preferentially expressed protein kinase
Protein Family
UniProt Gene Name
SPEG
UniProt Synonym Gene Names
APEG1; KIAA1297; APEG-1
UniProt Entry Name
SPEG_HUMAN
Uniprot Description
SPEG: Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. 4 isoforms of the human protein are produced by alternative promoter.
Protein type: EC 2.7.11.1; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; CAMK group; Trio family
Chromosomal Location of Human Ortholog: 2q35
Cellular Component: nucleus
Molecular Function: protein serine/threonine kinase activity; ATP binding
Biological Process: negative regulation of cell proliferation; muscle development; cardiac muscle cell development; in utero embryonic development; protein amino acid phosphorylation
Disease: Myopathy, Centronuclear, 5
Similar Products
Product Notes
The APEG1 speg (Catalog #AAA6004412) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APEG1 (Striated Muscle Preferentially Expressed Protein Kinase, Aortic Preferentially Expressed Protein 1, APEG-1, SPEG, KIAA1297) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APEG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the APEG1 speg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKPSPSQNRR SSDTGSKAPP TFKVSLMDQS VREGQDVIMS IRVQGEPKPV VSWLRNRQPV RPDQRRFAEE AEGGLCRLRI LAAERGDAGF YTCKAVNEYG ARQCEARLEV RGE. It is sometimes possible for the material contained within the vial of "APEG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
