Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged APCS is 0.1 ng/ml as a capture antibody.)

Mouse APCS Monoclonal Antibody | anti-APCS antibody

APCS (Amyloid P Component, Serum, MGC88159, PTX2, SAP) (Biotin)

Gene Names
APCS; SAP; PTX2; HEL-S-92n
Applications
Western Blot
Purity
Purified
Synonyms
APCS; Monoclonal Antibody; APCS (Amyloid P Component; Serum; MGC88159; PTX2; SAP) (Biotin); Amyloid P Component; SAP; anti-APCS antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
400000000
Specificity
Recognizes APCS.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-APCS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
APCS (NP_001630, 117aa-223aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged APCS is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged APCS is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-APCS antibody
The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. [provided by RefSeq]
Product Categories/Family for anti-APCS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
325
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
serum amyloid P-component
NCBI Official Synonym Full Names
amyloid P component, serum
NCBI Official Symbol
APCS
NCBI Official Synonym Symbols
SAP; PTX2; HEL-S-92n
NCBI Protein Information
serum amyloid P-component
UniProt Protein Name
Serum amyloid P-component
UniProt Gene Name
APCS
UniProt Synonym Gene Names
PTX2; SAP
UniProt Entry Name
SAMP_HUMAN

NCBI Description

The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. [provided by RefSeq, Sep 2008]

Uniprot Description

APCS: Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. May also function as a calcium-dependent lectin. SAP is a precursor of amyloid component P which is found in basement membrane and associated with amyloid deposits. Belongs to the pentaxin family.

Protein type: Secreted, signal peptide; Secreted; Chaperone

Chromosomal Location of Human Ortholog: 1q21-q23

Cellular Component: extracellular matrix; extracellular space; protein complex; extracellular region; nucleus

Molecular Function: complement component C1q binding; unfolded protein binding; virion binding; calcium ion binding; carbohydrate binding

Biological Process: protein folding; negative regulation of virion penetration into host cell; acute-phase response; negative regulation of acute inflammatory response; innate immune response; chaperone-mediated protein complex assembly; negative regulation of monocyte differentiation; negative regulation of viral reproduction

Research Articles on APCS

Similar Products

Product Notes

The APCS apcs (Catalog #AAA6172126) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's APCS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APCS apcs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APCS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.