Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human AP3B1 Monoclonal Antibody | anti-AP3B1 antibody

AP3B1 (AP-3 Complex Subunit beta-1, Adapter-related Protein Complex 3 Subunit beta-1, Adaptor Protein Complex AP-3 Subunit beta-1, Beta-3A-adaptin, Clathrin Assembly Protein Complex 3 beta-1 Large Chain, ADTB3A) (MaxLight 550)

Gene Names
AP3B1; PE; HPS; HPS2; ADTB3; ADTB3A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AP3B1; Monoclonal Antibody; AP3B1 (AP-3 Complex Subunit beta-1; Adapter-related Protein Complex 3 Subunit beta-1; Adaptor Protein Complex AP-3 Subunit beta-1; Beta-3A-adaptin; Clathrin Assembly Protein Complex 3 beta-1 Large Chain; ADTB3A) (MaxLight 550); anti-AP3B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B4
Specificity
Recognizes human AP3B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-AP3B1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa995-1095 from AP3B1 (NP_003655) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AP3B1 antibody
Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles.
Product Categories/Family for anti-AP3B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116,195 Da
NCBI Official Full Name
AP-3 complex subunit beta-1 isoform 1
NCBI Official Synonym Full Names
adaptor-related protein complex 3, beta 1 subunit
NCBI Official Symbol
AP3B1
NCBI Official Synonym Symbols
PE; HPS; HPS2; ADTB3; ADTB3A
NCBI Protein Information
AP-3 complex subunit beta-1; AP-3 complex beta-3A subunit; adaptor protein complex AP-3 subunit beta-1; adaptor-related protein complex 3 subunit beta-1; beta-3A-adaptin; clathrin assembly protein complex 3 beta-1 large chain
UniProt Protein Name
AP-3 complex subunit beta-1
Protein Family
UniProt Gene Name
AP3B1
UniProt Synonym Gene Names
ADTB3A
UniProt Entry Name
AP3B1_HUMAN

Uniprot Description

AP3B1: a subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles. Mutations in AP3B1 cause defects of various cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes, and are the cause of Hermansky-Pudlak syndrome 2. Two alternatively spliced isoforms have been described.

Protein type: Adaptor/scaffold; Vesicle

Chromosomal Location of Human Ortholog: 5q14.1

Cellular Component: Golgi apparatus; membrane; lysosomal membrane; clathrin coated vesicle membrane

Molecular Function: GTP-dependent protein binding; protein phosphatase binding

Biological Process: intracellular protein transport; protein targeting to lysosome; melanosome organization and biogenesis; anterograde synaptic vesicle transport; antigen processing and presentation, exogenous lipid antigen via MHC class Ib; positive regulation of NK T cell differentiation; blood coagulation; anterograde axon cargo transport

Disease: Hermansky-pudlak Syndrome 2

Similar Products

Product Notes

The AP3B1 ap3b1 (Catalog #AAA6210226) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AP3B1 (AP-3 Complex Subunit beta-1, Adapter-related Protein Complex 3 Subunit beta-1, Adaptor Protein Complex AP-3 Subunit beta-1, Beta-3A-adaptin, Clathrin Assembly Protein Complex 3 beta-1 Large Chain, ADTB3A) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AP3B1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AP3B1 ap3b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AP3B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.