Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (41.36kD).)

Mouse anti-Human AP2S1 Monoclonal Antibody | anti-AP2S1 antibody

AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit, AP2 Complex Subunit sigma 1, AP-2 Complex Subunit sigma 1, AP 17, AP17, AP17 delta, Clathrin Assembly Protein 2 Small Chain, Clathrin-associated/assembly/adaptor Protein Small 2, CLAPS2, Clathrin C

Gene Names
AP2S1; AP17; FBH3; HHC3; FBHOk; CLAPS2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AP2S1; Monoclonal Antibody; AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit; AP2 Complex Subunit sigma 1; AP-2 Complex Subunit sigma 1; AP 17; AP17; AP17 delta; Clathrin Assembly Protein 2 Small Chain; Clathrin-associated/assembly/adaptor Protein Small 2; CLAPS2; Clathrin C; anti-AP2S1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E4
Specificity
Recognizes human AP2S1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-AP2S1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-142 from human AP2S1 (AAH06337) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.36kD).)

Western Blot (WB) (Western Blot detection against Immunogen (41.36kD).)

Western Blot (WB)

(Western Blot analysis of AP2S1 expression in transfected 293T cell line by AP2S1 monoclonal antibody. Lane 1: AP2S1 transfected lysate (17kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AP2S1 expression in transfected 293T cell line by AP2S1 monoclonal antibody. Lane 1: AP2S1 transfected lysate (17kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of AP2S1 over-expressed 293 cell line, cotransfected with AP2S1 Validated Chimera RNAi ( (Lane 2) or non-transfected control (Lane 1). Blot probed with AP2S1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of AP2S1 over-expressed 293 cell line, cotransfected with AP2S1 Validated Chimera RNAi ( (Lane 2) or non-transfected control (Lane 1). Blot probed with AP2S1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-AP2S1 antibody
Adapter-related protein complex 2 sigma-1 subunit (AP2S1, AP17) is the component of the adaptor complexes which links clathrin to receptors in coated vesicles.It is the smallest polypeptide chain component of AP-2, a heterotetramer composed of two large adaptins (alpha-type subunit, AP2 alpha, and beta-type subunit, AP2 beta), a medium adaptin (mu-type subunit, AP2 mu1) and a small adaptin (sigma-type subunit, AP2S1).AP-2 is one of two major clathrin-associated protein complexes that interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration.
Product Categories/Family for anti-AP2S1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
12,417 Da
NCBI Official Full Name
Homo sapiens adaptor-related protein complex 2, sigma 1 subunit, mRNA
NCBI Official Synonym Full Names
adaptor related protein complex 2 sigma 1 subunit
NCBI Official Symbol
AP2S1
NCBI Official Synonym Symbols
AP17; FBH3; HHC3; FBHOk; CLAPS2
NCBI Protein Information
AP-2 complex subunit sigma
Protein Family

NCBI Description

One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Research Articles on AP2S1

Similar Products

Product Notes

The AP2S1 (Catalog #AAA6135315) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit, AP2 Complex Subunit sigma 1, AP-2 Complex Subunit sigma 1, AP 17, AP17, AP17 delta, Clathrin Assembly Protein 2 Small Chain, Clathrin-associated/assembly/adaptor Protein Small 2, CLAPS2, Clathrin C reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AP2S1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AP2S1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AP2S1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.