Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.44kD).)

Mouse anti-Human ANKRD17 Monoclonal Antibody | anti-ANKRD17 antibody

ANKRD17 (Ankyrin Repeat Domain-containing Protein 17, Gene Trap Ankyrin Repeat Protein, Serologically Defined Breast Cancer Antigen NY-BR-16, GTAR, KIAA0697) (PE)

Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANKRD17; Monoclonal Antibody; ANKRD17 (Ankyrin Repeat Domain-containing Protein 17; Gene Trap Ankyrin Repeat Protein; Serologically Defined Breast Cancer Antigen NY-BR-16; GTAR; KIAA0697) (PE); anti-ANKRD17 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B8
Specificity
Recognizes human ANKRD17.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2603
Applicable Applications for anti-ANKRD17 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2501-2604 from human ANKRD17 (NP_115593) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.44kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.44kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ANKRD17 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ANKRD17 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ANKRD17 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ANKRD17 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ANKRD17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ankyrin repeat domain-containing protein 17 isoform a
UniProt Protein Name
Ankyrin repeat domain-containing protein 17
UniProt Gene Name
ANKRD17
UniProt Synonym Gene Names
GTAR; KIAA0697
UniProt Entry Name
ANR17_HUMAN

Uniprot Description

ANKRD17: the earliest specific in situ marker of hepatic differentiation during embryogenesis, useful for characterization of inductive events involved in hepatic specification. Target of enterovirus 71 which is the major etiological agent of HFMD (hand, foot and mouth disease). Interacts with VP1 capsid protein of enterovirus 71 (EV71). Five alternatively processed human isoforms have been described.

Protein type: Cell development/differentiation

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: membrane; cytoplasm; nucleus; chromatin

Molecular Function: protein binding; chromatin binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; viral reproduction; defense response to bacterium; positive regulation of cell cycle; innate immune response; negative regulation of smooth muscle cell differentiation; blood vessel maturation; regulation of DNA replication

Similar Products

Product Notes

The ANKRD17 ankrd17 (Catalog #AAA6156513) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANKRD17 (Ankyrin Repeat Domain-containing Protein 17, Gene Trap Ankyrin Repeat Protein, Serologically Defined Breast Cancer Antigen NY-BR-16, GTAR, KIAA0697) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANKRD17 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANKRD17 ankrd17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANKRD17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.