Mouse anti-Human AMFR Monoclonal Antibody | anti-AMFR antibody

AMFR (Autocrine Motility Factor Receptor Precursor, Isoform 1, AMF Receptor, Isoform 1) (HRP)

Cat. Num. AAA6151193

• Gene Names: AMFR; GP78; RNF45
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AMFR; Monoclonal Antibody; AMFR (Autocrine Motility Factor Receptor Precursor; Isoform 1; AMF Receptor; Isoform 1) (HRP); anti-AMFR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D9
• Specificity: Recognizes human AMFR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-AMFR antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa451-550 from human AMFR (NP_001135) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Related Product Information for anti-AMFR antibody

Autocrine motility factor (AMF) is a protein secreted by tumor cells that stimulates tumor motility. The gene for AMFR encodes a 323aa polypeptide that has a single transmembrane domain and several putative glycosylation sites. The protein sequence has some homology to human tumor protein p53.

Product Categories/Family for anti-AMFR antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 21071001
• NCBI GeneID: 267
• NCBI Accession #: NP_001135
• NCBI GenBank Nucleotide #: NM_001144
• UniProt Accession #: Q9UKV5; P26442; Q8IZ70
• Molecular Weight: 72,996 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase AMFR
• NCBI Official Synonym Full Names: autocrine motility factor receptor, E3 ubiquitin protein ligase
• NCBI Official Symbol: AMFR
• NCBI Official Synonym Symbols: GP78; RNF45
• NCBI Protein Information: E3 ubiquitin-protein ligase AMFR; RING finger protein 45
• UniProt Protein Name: E3 ubiquitin-protein ligase AMFR
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: AMFR
• UniProt Synonym Gene Names: RNF45; AMF receptor

Uniprot Description

AMFR: E3 ubiquitin-protein ligase that mediates the polyubiquitination of a number of proteins such as CD3D, CYP3A4, CFTR and APOB for proteasomal degradation. Component of a VCP/p97- AMFR/gp78 complex that participates in the final step of endoplasmic reticulum-associated degradation (ERAD). The VCP/p97- AMFR/gp78 complex is involved in the sterol-accelerated ERAD degradation of HMGCR through binding to the HMGCR-INSIG complex at the ER membrane and initiating ubiquitination of HMGCR. The ubiquitinated HMGCR is then released from the ER by the complex into the cytosol for subsequent destruction. Also acts as a scaffold protein to assemble a complex that couples ubiquitination, retranslocation and deglycosylation. Mediates tumor invasion and metastasis. Interacts with RNF5. Also forms an ERAD complex containing VCP/p97, NGLY1; PSMC1; SAKS1 AND RAD23B required for coupling retrotranslocation, ubiquitination and deglycosylation. Interacts with DRL1. Interacts (through a region distinct from the RING finger) with UBE2G2/UBC7. Component of the VCP/p97-AMFR/gp78 complex that enhances VCP/p97 binding to polyubiquitinated proteins for their degradation by the endoplasmic reticulum-associated degradation (ERAD) pathway. Interacts (via the VIM) with VCP/p97. Interacts (via its membrane domain) with INSIG1; the interaction initiates the sterol-mediated ubiquitination and degradation of HMGCR by the ERAD pathway. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Endoplasmic reticulum; Ligase; Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis; Receptor, misc.; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 16q13

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; membrane; perinuclear region of cytoplasm; protein complex

Molecular Function: chaperone binding; protein binding; protein binding, bridging; receptor activity; ubiquitin-protein ligase activity

Biological Process: cell motility; ER-associated protein catabolic process; positive regulation of protein binding; protein autoubiquitination; protein oligomerization; protein polyubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process; signal transduction; ubiquitin-dependent protein catabolic process; unfolded protein response