Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (AMBP monoclonal antibody, Western Blot analysis of AMBP expression in A-549.)

Mouse anti-Human AMBP Monoclonal Antibody | anti-AMBP antibody

AMBP (a1-Microglobulin, Alpha-1-Microglobulin, A1M, Alpha-1-Microglobulin/bikunin Precursor, AMBP Protein, Alpha-1 Microglycoprotein, EDC1, Growth Inhibiting Protein 19, HCP, HI30, ITI, ITIL, IATIL, ITILC, Protein HC, UTI) (PE)

Gene Names
AMBP; A1M; HCP; ITI; UTI; EDC1; HI30; ITIL; IATIL; ITILC
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AMBP; Monoclonal Antibody; AMBP (a1-Microglobulin; Alpha-1-Microglobulin; A1M; Alpha-1-Microglobulin/bikunin Precursor; AMBP Protein; Alpha-1 Microglycoprotein; EDC1; Growth Inhibiting Protein 19; HCP; HI30; ITI; ITIL; IATIL; ITILC; Protein HC; UTI) (PE); anti-AMBP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F1
Specificity
Recognizes human AMBP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-AMBP antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa19-352 from human AMBP (BC041593, AAH41593) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(AMBP monoclonal antibody, Western Blot analysis of AMBP expression in A-549.)

Western Blot (WB) (AMBP monoclonal antibody, Western Blot analysis of AMBP expression in A-549.)

Western Blot (WB)

(Western Blot analysis of AMBP expression in transfected 293T cell line by AMBP monoclonal antibody. Lane 1: AMBP transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AMBP expression in transfected 293T cell line by AMBP monoclonal antibody. Lane 1: AMBP transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AMBP on formalin-fixed paraffin-embedded human liver. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to AMBP on formalin-fixed paraffin-embedded human liver. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AMBP on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to AMBP on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged AMBP is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AMBP is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-AMBP antibody
References
1. Differential proteomics analysis of amniotic fluid in pregnancies of increased nuchal translucency with normal karyotype. Cheng PJ, Wang TH, Huang SY, Kao CC, Lu JH, Hsiao CH, Steven Shaw SW.Prenat Diagn. 2011 Feb 10. doi: 10.1002 /pd.2719.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
259
Molecular Weight
38,999 Da
NCBI Official Full Name
Homo sapiens alpha-1-microglobulin/bikunin, mRNA
NCBI Official Synonym Full Names
alpha-1-microglobulin/bikunin precursor
NCBI Official Symbol
AMBP
NCBI Official Synonym Symbols
A1M; HCP; ITI; UTI; EDC1; HI30; ITIL; IATIL; ITILC
NCBI Protein Information
protein AMBP; bikunin; complex-forming glycoprotein heterogeneous in charge; growth-inhibiting protein 19; inter-alpha-trypsin inhibitor light chain; protein HC; trypstatin; uristatin; uronic-acid-rich protein
Protein Family

NCBI Description

This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008]

Research Articles on AMBP

Similar Products

Product Notes

The AMBP (Catalog #AAA6156495) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AMBP (a1-Microglobulin, Alpha-1-Microglobulin, A1M, Alpha-1-Microglobulin/bikunin Precursor, AMBP Protein, Alpha-1 Microglycoprotein, EDC1, Growth Inhibiting Protein 19, HCP, HI30, ITI, ITIL, IATIL, ITILC, Protein HC, UTI) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AMBP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AMBP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMBP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.