Mouse anti-Human AMACR Monoclonal Antibody | anti-AMACR antibody

AMACR (Alpha-methylacyl-CoA Racemase, 2-methylacyl-CoA Racemase) (HRP)

Cat. Num. AAA6151191

• Gene Names: AMACR; RM; RACE; CBAS4; AMACRD
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AMACR; Monoclonal Antibody; AMACR (Alpha-methylacyl-CoA Racemase; 2-methylacyl-CoA Racemase) (HRP); anti-AMACR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1D8
• Specificity: Recognizes human AMACR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-AMACR antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-199 from AMACR (AAH09471) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AMACR monoclonal antibody. Western Blot analysis of AMACR expression in HepG2.)

Related Product Information for anti-AMACR antibody

Alpha-methyacyl-CoA racemase (AMCR), is an enzyme invloved in beta oxidation of branched chain fatty acids and bile salt intermediates, and has recently been identified as a neomarker for prostate cancer, where it is over expressed. Several different isoforms have been reported that are produced either by extensinve alternatve splicing of 5 exons or by use of alternate initiation codons. At least 2 different transcripts, each derived from the 5 exons, have been reported, AMCR I and AMCR II. AMCR I is the most abundant form and enclodes for a 382aa protein (42kD). The other isoform AMCR II exhibits significant homolgy to fumarate hydratase and encodes a 288aa protein (32kD). Several other variants of IA and IIA isoforms have been characterized recently.

Product Categories/Family for anti-AMACR antibody

Antibodies; Enzymes; Racemase

NCBI and Uniprot Product Information

• NCBI GI #: 14495718
• NCBI GeneID: 23600
• Molecular Weight: 43,860 Da
• NCBI Official Full Name: Homo sapiens alpha-methylacyl-CoA racemase, mRNA
• NCBI Official Synonym Full Names: alpha-methylacyl-CoA racemase
• NCBI Official Symbol: AMACR
• NCBI Official Synonym Symbols: RM; RACE; CBAS4; AMACRD
• NCBI Protein Information: alpha-methylacyl-CoA racemase
• Protein Family: Alpha-methylacyl-CoA racemase

NCBI Description

This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. [provided by RefSeq, Mar 2011]