Mouse anti-Human ALLC Monoclonal Antibody | anti-ALLC antibody

ALLC (Allantoate Amidinohydrolase, Probable Allantoicase) (AP)

Cat. Num. AAA6129967

• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ALLC; Monoclonal Antibody; ALLC (Allantoate Amidinohydrolase; Probable Allantoicase) (AP); anti-ALLC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3D3
• Specificity: Recognizes human ALLC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 409

• Applicable Applications for anti-ALLC antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa235-345 from human ALLC (NP_060906) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GHPNNIIGVGGAKSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEAVIRQKWILPAHKWKPLLPVTKL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(Western Blot analysis of ALLC expression in transfected 293T cell line by ALLC monoclonal antibody. Lane 1: ALLC transfected lysate (45.6kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of ALLC transfected lysate using ALLC monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ALLC rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged ALLC is 1ng/ml as a capture antibody.)

Related Product Information for anti-ALLC antibody

This enzyme belongs to the family of hydrolases, those acting on carbon-nitrogen bonds other than peptide bonds, specifically in linear amidines. The systematic name of this enzyme class is allantoate amidinohydrolase. This enzyme participates in purine metabolism by facilitating the utilization of purines as secondary nitrogen sources under nitrogen-limiting conditions. While purine degradation converges to uric acid in all vertebrates, its further degradation varies from species to species. Uric acid is excreted by birds, reptiles, and some mammals that do not have a functional uricase gene, whereas other mammals produce allantoin. Amphibians and microorganisms produce ammonia and carbon dioxide using the uricolytic pathway. Allantoicase performs the second step in this pathway catalyzing the conversion of allantoate into ureidoglycolate and urea.

Product Categories/Family for anti-ALLC antibody

Antibodies; Enzymes

References

1. Xu Q, Schwarzenbacher R, Page R, Sims E, Abdubek P, Ambing E, Biorac T, Brinen LS, Cambell J, Canaves JM, Chiu HJ, Dai X, Deacon AM, DiDonato M, Elsliger MA, Floyd R, Godzik A, Grittini C, Grzechnik SK, Hampton E, Jaroszewski L, Karlak C, Klock HE, Koesema E, Kovarik JS, Kreusch A, Kuhn P, Lesley SA, Levin I, McMullan D, McPhillips TM, Miller MD, Morse A, Moy K, Ouyang J, Quijano K, Reyes R, Rezezadeh F, Robb A, Spraggon G, Stevens RC, van den Bedem H, Velasquez J, Vincent J, von Delft F, Wang X, West B, Wolf G, Hodgson KO, Wooley J, Wilson IA (August 2004). "Crystal structure of an allantoicase (YIR029W) from Saccharomyces cerevisiae at 2.4 A resolution". Proteins 56 (3): 619-24. doi:10.1002/prot.20164. PMID 15229895. 2. Leulliot N, Quevillon-Cheruel S, Sorel I, Graille M, Meyer P, Liger D, Blondeau K, Janin J, van Tilbeurgh H (May 2004). "Crystal structure of yeast allantoicase reveals a repeated jelly roll motif". J. Biol. Chem. 279 (22): 23447-52. doi:10.1074/jbc.M401336200. PMID 15020593.

NCBI and Uniprot Product Information

• NCBI GI #: 40548427
• NCBI Accession #: NP_060906.2
• NCBI GenBank Nucleotide #: NM_018436
• NCBI Official Full Name: allantoicase isoform a
• Protein Family: Allantoate amidohydrolase