Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human ALDH2 Monoclonal Antibody | anti-ALDH2 antibody

ALDH2 (Aldehyde Dehydrogenase, Mitochondrial, ALDH Class 2, ALDH-E2, ALDHI, ALDM) APC

Gene Names
ALDH2; ALDM; ALDHI; ALDH-E2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALDH2; Monoclonal Antibody; ALDH2 (Aldehyde Dehydrogenase; Mitochondrial; ALDH Class 2; ALDH-E2; ALDHI; ALDM) APC; anti-ALDH2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E5
Specificity
Recognizes human ALDH2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ALDH2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa408-517 from human ALDH2 (AAH02967). MW of the GST tag alone is 26kD.
Immunogen Sequence
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(ALDH2 monoclonal antibody, Western Blot analysis of ALDH2 expression in MCF-7.)

Western Blot (WB) (ALDH2 monoclonal antibody, Western Blot analysis of ALDH2 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of ALDH2 expression in transfected 293T cell line by ALDH2 monoclonal antibody. Lane 1: ALDH2 transfected lysate (56.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ALDH2 expression in transfected 293T cell line by ALDH2 monoclonal antibody. Lane 1: ALDH2 transfected lysate (56.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ALDH2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ALDH2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ALDH2 antibody
ALDH2 belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Asians have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Asians than among Caucasians could be related to the absence of the mitochondrial isozyme.
Product Categories/Family for anti-ALDH2 antibody
References
1. Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression. Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK.PLoS Comput Biol. 2011 Jun; 7(6):e1002093. Epub 2011 Jun 30.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
217
Molecular Weight
50,989 Da
NCBI Official Full Name
Homo sapiens aldehyde dehydrogenase 2 family (mitochondrial), mRNA
NCBI Official Synonym Full Names
aldehyde dehydrogenase 2 family (mitochondrial)
NCBI Official Symbol
ALDH2
NCBI Official Synonym Symbols
ALDM; ALDHI; ALDH-E2
NCBI Protein Information
aldehyde dehydrogenase, mitochondrial

NCBI Description

This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Mar 2011]

Research Articles on ALDH2

Similar Products

Product Notes

The ALDH2 (Catalog #AAA6135257) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALDH2 (Aldehyde Dehydrogenase, Mitochondrial, ALDH Class 2, ALDH-E2, ALDHI, ALDM) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALDH2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALDH2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.