Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human ALAS1 Monoclonal Antibody | anti-ALAS1 antibody

ALAS1 (5-aminolevulinate Synthase, Nonspecific, Mitochondrial, ALAS-H, 5-aminolevulinic Acid Synthase 1, ALAS3, ALASH, Delta-ALA Synthase 1, Delta-aminolevulinate Synthase 1, OK/SW-cl.121) (HRP)

Gene Names
ALAS1; ALAS; MIG4; ALAS3; ALASH; ALAS-H
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALAS1; Monoclonal Antibody; ALAS1 (5-aminolevulinate Synthase; Nonspecific; Mitochondrial; ALAS-H; 5-aminolevulinic Acid Synthase 1; ALAS3; ALASH; Delta-ALA Synthase 1; Delta-aminolevulinate Synthase 1; OK/SW-cl.121) (HRP); anti-ALAS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G10
Specificity
Recognizes human ALAS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ALAS1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-98 from human ALAS1 (NP_000679) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(ALAS1 monoclonal antibody Western Blot analysis of ALAS1 expression in JAR.)

Western Blot (WB) (ALAS1 monoclonal antibody Western Blot analysis of ALAS1 expression in JAR.)

Testing Data

(Detection limit for recombinant GST tagged ALAS1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ALAS1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-ALAS1 antibody
ALAS-1 (EC 2.3.1.37) is a nuclear-encoded mitochondrial matrix enzyme catalyzing the condensation of glycine with succinyl-CoA to form delta-amino levulinate, CO2 and CoA. It regulates the first and rate-limiting step of heme biosynthetic pathway. It is one of the two isoforms of ALAS and is a pyridoxal-5' phosphate dependent housekeeping enzyme. It is ubiquitously expressed and is responsible of providing heme for cytochromes and other hemoproteins. ALAS1 in liver undergoes negative feedback regulation by heme. Transcription of ALAS1 gene is stimulated by cAMP and respiratory uncoupling whereas Phorbol esters and insulin repress ALAS1 gene expression. ALAS1 is suggested to be involved in reciprocal regulation of Heme biosynthesis and circadian clock suggesting a potential target for treatment of circadian disorders. ALAS1 gene expression is down regulated in Acute Liver failure resulting in altered heme metabolism and liver function.
Product Categories/Family for anti-ALAS1 antibody
References
1. PGC-1{alpha} is not mandatory for exercise- and training-induced adaptive gene responsens in mouse skeletal muscle. Leick L, Wojtaszewski JF, Johansen ST, Kiilerich K, Comes G, Hellsten Y, Hidalgo J, Pilegaard H.Am J Physiol Endocrinol Metab. 2008 Feb;294(2):E463-74. Epub 2007 Dec 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
211
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,581 Da
NCBI Official Full Name
5-aminolevulinate synthase, nonspecific, mitochondrial isoform 1
NCBI Official Synonym Full Names
5'-aminolevulinate synthase 1
NCBI Official Symbol
ALAS1
NCBI Official Synonym Symbols
ALAS; MIG4; ALAS3; ALASH; ALAS-H
NCBI Protein Information
5-aminolevulinate synthase, nonspecific, mitochondrial; 5-aminolevulinic acid synthase 1; aminolevulinate, delta-, synthase 1; delta-ALA synthase 1; delta-aminolevulinate synthase 1; migration-inducing protein 4
UniProt Protein Name
5-aminolevulinate synthase
Protein Family
UniProt Gene Name
ALAS1
UniProt Entry Name
Q5JAM2_HUMAN

Similar Products

Product Notes

The ALAS1 alas1 (Catalog #AAA6151159) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALAS1 (5-aminolevulinate Synthase, Nonspecific, Mitochondrial, ALAS-H, 5-aminolevulinic Acid Synthase 1, ALAS3, ALASH, Delta-ALA Synthase 1, Delta-aminolevulinate Synthase 1, OK/SW-cl.121) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALAS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALAS1 alas1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALAS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.