Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to AKR1B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Mouse anti-Human AKR1B1 Monoclonal Antibody | anti-AKR1B1 antibody

AKR1B1 (Aldose Reductase, AR, Aldehyde Reductase, Aldo-keto Reductase Family 1 Member B1, ALDR1) (PE)

Gene Names
AKR1B1; AR; ADR; ALR2; ALDR1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKR1B1; Monoclonal Antibody; AKR1B1 (Aldose Reductase; AR; Aldehyde Reductase; Aldo-keto Reductase Family 1 Member B1; ALDR1) (PE); anti-AKR1B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D12
Specificity
Recognizes human AKR1B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-AKR1B1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-316 from human AKR1B1 (AAH00260.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to AKR1B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to AKR1B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged AKR1B1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AKR1B1 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-AKR1B1 antibody
References
1. Proteasome inhibitors MG-132 and bortezomib induce AKR1C1; AKR1C3; AKR1B1; and AKR1B10 in human colon cancer cell lines SW-480 and HT-29. Ebert B, Kisiela M, Wsol V, Maser E.Chem Biol Interact. 2011 Jan 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
231
Molecular Weight
35,853 Da
NCBI Official Full Name
Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase), mRNA
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member B
NCBI Official Symbol
AKR1B1
NCBI Official Synonym Symbols
AR; ADR; ALR2; ALDR1
NCBI Protein Information
aldose reductase
Protein Family

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq, Feb 2009]

Research Articles on AKR1B1

Similar Products

Product Notes

The AKR1B1 (Catalog #AAA6156454) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKR1B1 (Aldose Reductase, AR, Aldehyde Reductase, Aldo-keto Reductase Family 1 Member B1, ALDR1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKR1B1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKR1B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.