Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged AKAP6 is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human AKAP6 Monoclonal Antibody | anti-AKAP6 antibody

AKAP6 (A-kinase Anchor Protein 6, AKAP-6, A-kinase Anchor Protein 100kD, AKAP 100, Protein Kinase A-anchoring Protein 6, PRKA6, mAKAP, AKAP100, KIAA0311) (FITC)

Gene Names
AKAP6; ADAP6; PRKA6; mAKAP; ADAP100; AKAP100
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKAP6; Monoclonal Antibody; AKAP6 (A-kinase Anchor Protein 6; AKAP-6; A-kinase Anchor Protein 100kD; AKAP 100; Protein Kinase A-anchoring Protein 6; PRKA6; mAKAP; AKAP100; KIAA0311) (FITC); anti-AKAP6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E7
Specificity
Recognizes human AKAP6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
2319
Applicable Applications for anti-AKAP6 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2221-2318 from AKAP6 (NP_004265) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDLSLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged AKAP6 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AKAP6 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-AKAP6 antibody
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum.
Product Categories/Family for anti-AKAP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
A-kinase anchor protein 6
NCBI Official Synonym Full Names
A-kinase anchoring protein 6
NCBI Official Symbol
AKAP6
NCBI Official Synonym Symbols
ADAP6; PRKA6; mAKAP; ADAP100; AKAP100
NCBI Protein Information
A-kinase anchor protein 6
UniProt Protein Name
A-kinase anchor protein 6
Protein Family
UniProt Gene Name
AKAP6
UniProt Synonym Gene Names
AKAP100; KIAA0311
UniProt Entry Name
AKAP6_HUMAN

NCBI Description

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is highly expressed in various brain regions and cardiac and skeletal muscle. It is specifically localized to the sarcoplasmic reticulum and nuclear membrane, and is involved in anchoring PKA to the nuclear membrane or sarcoplasmic reticulum. [provided by RefSeq, Jul 2008]

Research Articles on AKAP6

Similar Products

Product Notes

The AKAP6 akap6 (Catalog #AAA6145842) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKAP6 (A-kinase Anchor Protein 6, AKAP-6, A-kinase Anchor Protein 100kD, AKAP 100, Protein Kinase A-anchoring Protein 6, PRKA6, mAKAP, AKAP100, KIAA0311) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKAP6 akap6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKAP6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.