Mouse anti-Human AIP1 Monoclonal Antibody | anti-AIP1 antibody

AIP1 (MAGI2, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 2, Atrophin-1-interacting Protein 1, AIP-1, Atrophin-1-interacting Protein A, Membrane-associated Guanylate Kinase Inverted 2, MAGI-2, ACVRINP1, KIAA0705) (HRP)

Cat. Num. AAA6151136

• Gene Names: MAGI2; AIP1; AIP-1; ARIP1; SSCAM; MAGI-2; NPHS15; ACVRIP1
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AIP1; Monoclonal Antibody; AIP1 (MAGI2; Membrane-associated Guanylate Kinase; WW and PDZ Domain-containing Protein 2; Atrophin-1-interacting Protein 1; AIP-1; Atrophin-1-interacting Protein A; Membrane-associated Guanylate Kinase Inverted 2; MAGI-2; ACVRINP1; KIAA0705) (HRP); anti-AIP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6C8
• Specificity: Recognizes human MAGI2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 6975

• Applicable Applications for anti-AIP1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa519-628 from MAGI2 (NP_036433) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MAGI2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-AIP1 antibody

Atrophin-1 (AIP1) contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. This protein is brain specific, where it appears to be widely expressed in both neurons and glia.

Product Categories/Family for anti-AIP1 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 1519241920
• NCBI GeneID: 9863
• NCBI Accession #: NM_012301.4
• NCBI GenBank Nucleotide #: NM_012301
• UniProt Accession #: Q86UL8
• NCBI Official Full Name: Homo sapiens membrane associated guanylate kinase, WW and PDZ domain containing 2 (MAGI2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: membrane associated guanylate kinase, WW and PDZ domain containing 2
• NCBI Official Symbol: MAGI2
• NCBI Official Synonym Symbols: AIP1; AIP-1; ARIP1; SSCAM; MAGI-2; NPHS15; ACVRIP1
• NCBI Protein Information: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
• UniProt Protein Name: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
• Protein Family: Actin-interacting protein
• UniProt Gene Name: MAGI2
• UniProt Synonym Gene Names: ACVRINP1; AIP1; KIAA0705; AIP-1; MAGI-2
• UniProt Entry Name: MAGI2_HUMAN

NCBI Description

The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. [provided by RefSeq, Jul 2008]

Uniprot Description

AIP1: a scaffold molecule at synaptic junctions that apparently couples neurotransmitter receptors and cell adhesion proteins. Contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. Contains two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. This protein is brain specific, where it appears to be widely expressed in both neurons and glia. Enhances the ability of PTEN to suppress AKT1 activation. Two splice-variant isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: protein complex; tight junction; perinuclear region of cytoplasm; cytoplasm; postsynaptic density; dendrite; late endosome; plasma membrane; synapse; nucleus

Molecular Function: signal transducer activity; protein binding; receptor signaling complex scaffold activity; beta-1 adrenergic receptor binding; SMAD binding; phosphatase binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; negative regulation of activin receptor signaling pathway; negative regulation of cell proliferation; negative regulation of protein kinase B signaling cascade; protein heterooligomerization; positive regulation of receptor internalization; negative regulation of cell migration; receptor clustering; cytoplasmic transport