Mouse AIF Monoclonal Antibody | anti-AIF antibody

Anti-AIF Antibody (Monoclonal, 2I5)

Cat. Num. AAA1752806

• Gene Names: AIF1; IBA1; IRT1; AIF-1; IRT-1
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
• Purity: Immunogen Affinity Purified
• Synonyms: AIF; Monoclonal Antibody; Anti-AIF Antibody (Monoclonal; 2I5); Apoptosis-inducing factor 1; mitochondrial; apoptosis-inducing factor; mitochondrion-associated; 1; Allograft inflammatory factor 1; AIF-1; Ionized calcium-binding adapter molecule 1; Protein G1; AIF1; G1; IBA1; anti-AIF antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized
• Sequence Length: 147

• Applicable Applications for anti-AIF antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Immunofluorescence (IF), Flow Cytometry (FC/FACS)
• Application Notes: WB: 0.1-0.5ug/ml; IHC-P: 0.5-1ug/ml; IF: 2ug/ml; FC/FACS: 1-3ug/1x106 cells
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
• Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Relevant Detection Systems: Relevant Detection Systems
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500mug/ml.
• Relevant Detection Systems: Relevant Detection Systems
• Relevant Detection Systems: We recommend Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC(P).
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Related Product Information for anti-AIF antibody

Description: Mouse IgG monoclonal antibody for AIF detection. Tested with WB, IHC-P, IF, FCM in Human; Mouse; Rat.

Background: Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.

References

1.Ghezzi, D., Sevrioukova, I., Invernizzi, F., Lamperti, C., Mora, M., D'Adamo, P., Novara, F., Zuffardi, O., Uziel, G., Zeviani, M. Severe X-linked mitochondrial encephalomyopathy associated with a mutation in apoptosis-inducing factor. Am. J. Hum. Genet. 86: 639-649, 2010.  2.Rinaldi, C., Grunseich, C., Sevrioukova, I. F., Schindler, A., Horkayne-Szakaly, I., Lamperti, C., Landoure, G., Kennerson, M. L., Burnett, B. G., Bonnemann, C., Biesecker, L. G., Ghezzi, D., Zeviani, M., Fischbeck, K. H. Cowchock syndrome is associated with a mutation in apoptosis-inducing factor. Am. J. Hum. Genet. 91: 1095-1102, 2012. 3.Yu, S.-W., Andrabi, S. A., Wang, H., Kim, N. S., Poirier, G. G., Dawson, T. M., Dawson, V. L. Apoptosis-inducing factor mediates poly(ADP-ribose) (PAR) polymer-induced cell death. Proc. Nat. Acad. Sci. 103: 18314-18319, 2006.

NCBI and Uniprot Product Information

• NCBI GI #: 1703217
• NCBI GeneID: 199
• UniProt Accession #: P55008
• NCBI Official Full Name: Allograft inflammatory factor 1
• NCBI Official Synonym Full Names: allograft inflammatory factor 1
• NCBI Official Symbol: AIF1
• NCBI Official Synonym Symbols: IBA1; IRT1; AIF-1; IRT-1
• NCBI Protein Information: allograft inflammatory factor 1
• UniProt Protein Name: Allograft inflammatory factor 1
• Protein Family: Putative apoptosis-inducing factor
• UniProt Gene Name: AIF1
• UniProt Synonym Gene Names: G1; IBA1; AIF-1
• UniProt Entry Name: AIF1_HUMAN

NCBI Description

This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]

Uniprot Description

AIF1: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T- lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: perinuclear region of cytoplasm; lamellipodium; cytoplasm; actin filament; perikaryon; nucleus; cytosol; phagocytic cup

Molecular Function: actin filament binding; calcium ion binding

Biological Process: actin filament bundle formation; positive regulation of nitric oxide biosynthetic process; negative regulation of smooth muscle cell proliferation; positive regulation of smooth muscle cell proliferation; microglial cell activation; Rac protein signal transduction; cellular response to hormone stimulus; actin filament polymerization; positive regulation of muscle hyperplasia; cellular response to extracellular stimulus; positive regulation of T cell proliferation; response to axon injury; positive regulation of protein amino acid phosphorylation; phagocytosis, engulfment; response to electrical stimulus; inflammatory response; negative regulation of apoptosis