Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse AHR Monoclonal Antibody | anti-AHR antibody

AHR (Aryl Hydrocarbon Receptor, bHLHe76) (MaxLight 550)

Gene Names
AHR; bHLHe76
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
AHR; Monoclonal Antibody; AHR (Aryl Hydrocarbon Receptor; bHLHe76) (MaxLight 550); Aryl Hydrocarbon Receptor; bHLHe76; anti-AHR antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
4G7
Specificity
Recognizes AHR.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-AHR antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AHR (NP_001612, 721aa-820aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AHR antibody
This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. [provided by RefSeq]
Product Categories/Family for anti-AHR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
196
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96,147 Da
NCBI Official Full Name
aryl hydrocarbon receptor
NCBI Official Synonym Full Names
aryl hydrocarbon receptor
NCBI Official Symbol
AHR
NCBI Official Synonym Symbols
bHLHe76
NCBI Protein Information
aryl hydrocarbon receptor; AH-receptor; ah receptor; aromatic hydrocarbon receptor; class E basic helix-loop-helix protein 76
UniProt Protein Name
Aryl hydrocarbon receptor
Protein Family
UniProt Gene Name
AHR
UniProt Synonym Gene Names
BHLHE76; Ah receptor; AhR; bHLHe76
UniProt Entry Name
AHR_HUMAN

Uniprot Description

AHR: a nuclear receptor for aryl hydrocarbons involved in xenobiotic metabolism, cell cycle regulation, and development in response to both endogenous and environmental signals. AhR was initially identified as a receptor for dioxins, which are environmental pollutants generated by waste incineration and other industrial processes . AhR ligands include polycyclic aromatic hydrocarbons, including the carcinogen benzo(a)pyrene and other components of cigarette smoke. Naturally occurring AhR ligands include flavonoids, which are aromatic plant secondary compounds commonly found in vegetables and fruits. Cytoplasmic aryl hydrocarbon receptors are found in protein complexes with heat shock proteins. Upon ligand binding, AhR dissociates from heat shock proteins and translocate to the nucleus where it dimerizes with AhR nuclear translocator (ARNT, HIF-1b). The AhR/ARNT heterodimer binds to nuclear xenobiotic response elements to control the expression of genes associated with xenobiotic metabolism, including several cytochrome P450 genes. AhR is ubiquitously expressed and is thought to play a role in regulation of cell proliferation and differentiation, cytokine expression, and xenobiotic metabolism. Research studies link AhR activity with the control of regulatory T-cell and T-helper 17 cell differentiation, regulation of the inflammatory response, and the onset of lung cancer.

Protein type: DNA-binding; Transcription factor; Nuclear receptor

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein dimerization activity; signal transducer activity; protein binding; ligand-dependent nuclear receptor activity; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; Hsp90 protein binding; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; prostate gland development; blood vessel development; intracellular receptor-mediated signaling pathway; apoptosis; response to toxin; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; cell cycle; regulation of transcription from RNA polymerase II promoter; response to xenobiotic stimulus; regulation of transcription, DNA-dependent; regulation of gene expression; xenobiotic metabolic process; positive regulation of transcription from RNA polymerase II promoter; regulation of B cell proliferation; circadian regulation of gene expression; positive regulation of transcriptional preinitiation complex assembly; negative regulation of transcription, DNA-dependent

Similar Products

Product Notes

The AHR ahr (Catalog #AAA6215770) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AHR can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AHR ahr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AHR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.