Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (45.36kD).)

Mouse anti-Human AGR2 Monoclonal Antibody | anti-AGR2 antibody

AGR2 (Anterior Gradient Protein 2 Homolog, Secreted Cement Gland Protein XAG-2 Homolog, AG-2, hAG-2, HPC8, AG2, Anterior Gradient 2, UNQ515/PRO1030) APC

Gene Names
AGR2; AG2; AG-2; HPC8; GOB-4; HAG-2; XAG-2; PDIA17; HEL-S-116
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Affinity Chromatography
Synonyms
AGR2; Monoclonal Antibody; AGR2 (Anterior Gradient Protein 2 Homolog; Secreted Cement Gland Protein XAG-2 Homolog; AG-2; hAG-2; HPC8; AG2; Anterior Gradient 2; UNQ515/PRO1030) APC; anti-AGR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E5
Specificity
Recognizes human AGR2.
Purity/Purification
Purified by Affinity Chromatography
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-AGR2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-175 from AGR2 (AAH15503) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.36kD).)

Western Blot (WB) (Western Blot detection against Immunogen (45.36kD).)

Western Blot (WB)

(Western Blot analysis of AGR2 expression in human colon using 123071.)

Western Blot (WB) (Western Blot analysis of AGR2 expression in human colon using 123071.)

Western Blot (WB)

(Western Blot analysis of AGR2 expression in MCF-7 using 123071.)

Western Blot (WB) (Western Blot analysis of AGR2 expression in MCF-7 using 123071.)

Western Blot (WB)

(Western Blot analysis of AGR2 expression in transfected 293T cell line by 123071. Lane 1: AGR2 transfected lysate (20kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AGR2 expression in transfected 293T cell line by 123071. Lane 1: AGR2 transfected lysate (20kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged AGR2 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AGR2 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-AGR2 antibody
Anterior gradient 2 (AGR2) is known as a cancer cell marker specifically up-regulated in response to depletion of serum and oxygen. AGR2 has been identified as a tumor marker in primary and secondary cancer lesions, and as a marker for detection of circulating tumor cells (CTCs). Elevated levels of AGR2 are known to increase the metastatic potential of cancer cells, but conditions leading to increased expression of AGR2 are not well understood.
Product Categories/Family for anti-AGR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
19,979 Da
NCBI Official Full Name
Homo sapiens anterior gradient homolog 2 (Xenopus laevis), mRNA
NCBI Official Synonym Full Names
anterior gradient 2, protein disulphide isomerase family member
NCBI Official Symbol
AGR2
NCBI Official Synonym Symbols
AG2; AG-2; HPC8; GOB-4; HAG-2; XAG-2; PDIA17; HEL-S-116
NCBI Protein Information
anterior gradient protein 2 homolog
Protein Family

NCBI Description

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017]

Research Articles on AGR2

Similar Products

Product Notes

The AGR2 (Catalog #AAA6135217) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AGR2 (Anterior Gradient Protein 2 Homolog, Secreted Cement Gland Protein XAG-2 Homolog, AG-2, hAG-2, HPC8, AG2, Anterior Gradient 2, UNQ515/PRO1030) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AGR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AGR2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AGR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.