Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AGER expression in transfected 293T cell line by AGER monoclonal antibody (M05), clone 1D1.Lane 1: AGER transfected lysate (42.8 KDa).Lane 2: Non-transfected lysate.)

Mouse AGER Monoclonal Antibody | anti-AGER antibody

AGER (Advanced Glycosylation End Product-Specific Receptor, MGC22357, RAGE) (PE)

Gene Names
AGER; RAGE
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
AGER; Monoclonal Antibody; AGER (Advanced Glycosylation End Product-Specific Receptor; MGC22357; RAGE) (PE); Advanced Glycosylation End Product-Specific Receptor; RAGE; anti-AGER antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D1
Specificity
Recognizes AGER.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-AGER antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AGER (AAH20669.1, 87aa-197aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AGER expression in transfected 293T cell line by AGER monoclonal antibody (M05), clone 1D1.Lane 1: AGER transfected lysate (42.8 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AGER expression in transfected 293T cell line by AGER monoclonal antibody (M05), clone 1D1.Lane 1: AGER transfected lysate (42.8 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-AGER antibody
This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]
Product Categories/Family for anti-AGER antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
177
Molecular Weight
41,098 Da
NCBI Official Full Name
Advanced glycosylation end product-specific receptor
NCBI Official Synonym Full Names
advanced glycosylation end product-specific receptor
NCBI Official Symbol
AGER
NCBI Official Synonym Symbols
RAGE
NCBI Protein Information
advanced glycosylation end product-specific receptor; RAGE isoform sRAGE-delta; RAGE isoform NtRAGE-delta; receptor for advanced glycation end-products variant 20

NCBI Description

The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). [provided by RefSeq, May 2011]

Research Articles on AGER

Similar Products

Product Notes

The AGER (Catalog #AAA6186531) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AGER can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AGER for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AGER, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.