Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ADORA3 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human ADORA3 Monoclonal Antibody | anti-ADORA3 antibody

ADORA3 (Adenosine Receptor A3, UNQ1931/PRO4406) (PE)

Gene Names
ADORA3; A3AR
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADORA3; Monoclonal Antibody; ADORA3 (Adenosine Receptor A3; UNQ1931/PRO4406) (PE); anti-ADORA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A3
Specificity
Recognizes human ADORA3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ADORA3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa121-225 from human ADORA3 (AAH29831) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ADORA3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADORA3 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-ADORA3 antibody
A3 Adenosine Receptor is a widely expressed receptor that mediates the multiple functions of adenosine. For example, this receptor is believed to mediate the protective effect of adenosine released during cardiac ischemia. In lungs, the receptor mediates inhibition of eosinophil chemotaxis and may be useful in the treatment of eosinophil-dependent diseases such as asthma and rhinitis. Adenosine A3 Receptor has been reported mostly in brain, lung, liver, heart, kidney, and testis. ESTs have been isolated from heart/melanocyte/uterus, kidney, pituitary, and placenta libraries.
Product Categories/Family for anti-ADORA3 antibody
References
1. Adenosine receptor expression in rheumatoid synovium: a basis for methotrexate action. Stamp LK, Hazlett J, Roberts RL, Frampton C, Highton J, Hessian PA.Arthritis Res Ther. 2012 Jun 8;14(3):R138.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
140
Molecular Weight
38,976 Da
NCBI Official Full Name
Homo sapiens adenosine A3 receptor, mRNA
NCBI Official Synonym Full Names
adenosine A3 receptor
NCBI Official Symbol
ADORA3
NCBI Official Synonym Symbols
A3AR
NCBI Protein Information
adenosine receptor A3
Protein Family

NCBI Description

This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5' terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobulin domain-containing protein. [provided by RefSeq, Nov 2014]

Research Articles on ADORA3

Similar Products

Product Notes

The ADORA3 (Catalog #AAA6156413) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADORA3 (Adenosine Receptor A3, UNQ1931/PRO4406) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADORA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADORA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADORA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.