Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ADNP is 0.1 ng/ml as a capture antibody.)

Mouse ADNP Monoclonal Antibody | anti-ADNP antibody

ADNP (Activity-Dependent neuroprotector Homeobox, ADNP1, KIAA0784) (FITC)

Gene Names
ADNP; ADNP1; HVDAS; MRD28
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
ADNP; Monoclonal Antibody; ADNP (Activity-Dependent neuroprotector Homeobox; ADNP1; KIAA0784) (FITC); Activity-Dependent neuroprotector Homeobox; KIAA0784; anti-ADNP antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C5
Specificity
Recognizes ADNP.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ADNP antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ADNP (NP_056154, 1018aa-1102aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ADNP is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADNP is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of ADNP expression in transfected 293T cell line by ADNP monoclonal antibody (M02), clone 2C5.Lane 1: ADNP transfected lysate (Predicted MW: 123.6 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ADNP expression in transfected 293T cell line by ADNP monoclonal antibody (M02), clone 2C5.Lane 1: ADNP transfected lysate (Predicted MW: 123.6 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ADNP on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ADNP on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ADNP on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ADNP on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-ADNP antibody
Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq]
Product Categories/Family for anti-ADNP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123,563 Da
NCBI Official Full Name
activity-dependent neuroprotector homeobox protein
NCBI Official Synonym Full Names
activity-dependent neuroprotector homeobox
NCBI Official Symbol
ADNP
NCBI Official Synonym Symbols
ADNP1; HVDAS; MRD28
NCBI Protein Information
activity-dependent neuroprotector homeobox protein
UniProt Protein Name
Activity-dependent neuroprotector homeobox protein
Protein Family
UniProt Gene Name
ADNP
UniProt Synonym Gene Names
ADNP1; KIAA0784
UniProt Entry Name
ADNP_HUMAN

NCBI Description

Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

ADNP: Potential transcription factor. May mediate some of the neuroprotective peptide VIP-associated effects involving normal growth and cancer proliferation.

Protein type: Apoptosis; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 20q13.13

Cellular Component: extracellular space; nucleus

Molecular Function: protein binding; DNA binding; metal ion binding; chromatin binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of neuron apoptosis

Disease: Mental Retardation, Autosomal Dominant 28

Research Articles on ADNP

Similar Products

Product Notes

The ADNP adnp (Catalog #AAA6178416) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ADNP can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADNP adnp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADNP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.