Mouse anti-Human ADCY5 Monoclonal Antibody | anti-ADCY5 antibody

ADCY5 (Adenylate Cyclase Type 5, ATP Pyrophosphate-lyase 5, Adenylate Cyclase Type V, Adenylyl Cyclase 5) (AP)

Cat. Num. AAA6129891

• Gene Names: ADCY5; AC5; FDFM
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ADCY5; Monoclonal Antibody; ADCY5 (Adenylate Cyclase Type 5; ATP Pyrophosphate-lyase 5; Adenylate Cyclase Type V; Adenylyl Cyclase 5) (AP); anti-ADCY5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3E6
• Specificity: Recognizes human ADCY5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1261

• Applicable Applications for anti-ADCY5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1152-1262 from human ADCY5 (NP_899200) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged ADCY5 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-ADCY5 antibody

Antibodies; Enzymes

References

1. An adenylyl cyclase signaling pathway predicts direct dopaminergic input to vestibular hair cells. Drescher MJ, Cho WJ, Folbe AJ, Selvakumar D, Kewson DT, Abu-Hamdan MD, Oh CK, Ramakrishnan NA, Hatfield JS, Khan KM, Anne S, Harpool EC, Drescher DG.Neuroscience. 2010 Sep 29.

NCBI and Uniprot Product Information

• NCBI GI #: 34486092
• NCBI GeneID: 111
• NCBI Accession #: NP_899200
• NCBI GenBank Nucleotide #: NM_183357
• UniProt Accession #: O95622
• NCBI Official Full Name: adenylate cyclase type 5 isoform 1
• NCBI Official Synonym Full Names: adenylate cyclase 5
• NCBI Official Symbol: ADCY5
• NCBI Official Synonym Symbols: AC5; FDFM
• NCBI Protein Information: adenylate cyclase type 5
• UniProt Protein Name: Adenylate cyclase type 5
• Protein Family: Adenylate cyclase
• UniProt Gene Name: ADCY5
• UniProt Synonym Gene Names: AC5

NCBI Description

This gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha subunit of G protein-coupled receptors and is inhibited by protein kinase A, calcium and Gi alpha subunits. Single nucleotide polymorphisms in this gene may be associated with low birth weight and type 2 diabetes. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling (PubMed:15385642, PubMed:26206488, PubMed:24700542). Mediates signaling downstream of ADRB1 (PubMed:24700542). Regulates the increase of free cytosolic Ca2+ in response to increased blood glucose levels and contributes to the regulation of Ca2+-dependent insulin secretion (PubMed:24740569).