Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human ACVR2B Monoclonal Antibody | anti-ACVR2B antibody

ACVR2B (Activin Receptor Type 2B, Activin Receptor Type IIB, ACTR-IIB) (Biotin)

Gene Names
ACVR2B; HTX4; ACTRIIB; ActR-IIB
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACVR2B; Monoclonal Antibody; ACVR2B (Activin Receptor Type 2B; Activin Receptor Type IIB; ACTR-IIB) (Biotin); anti-ACVR2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C11
Specificity
Recognizes human ACVR2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ACVR2B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-120 from human ACVR2B (NP_001097) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWANSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of ACVR2B expression in transfected 293T cell line by ACVR2B monoclonal antibody. Lane 1: ACVR2B transfected lysate (57.724kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ACVR2B expression in transfected 293T cell line by ACVR2B monoclonal antibody. Lane 1: ACVR2B transfected lysate (57.724kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ACVR2B is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACVR2B is ~1ng/ml as a capture antibody.)
Related Product Information for anti-ACVR2B antibody
Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. ACVR2B (activin A type IIB receptor)displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
Product Categories/Family for anti-ACVR2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
93
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
activin receptor type-2B
NCBI Official Synonym Full Names
activin A receptor, type IIB
NCBI Official Symbol
ACVR2B
NCBI Official Synonym Symbols
HTX4; ACTRIIB; ActR-IIB
NCBI Protein Information
activin receptor type-2B
UniProt Protein Name
Activin receptor type-2B
Protein Family
UniProt Gene Name
ACVR2B
UniProt Synonym Gene Names
ACTR-IIB
UniProt Entry Name
AVR2B_HUMAN

Uniprot Description

ACVR2B: a tyrosine-kinase like receptor kinase of the STKR family. The holoreceptor receptor is a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. Each is composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic kinase domain. Type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptor kinases are apparently constitutively active. The IIB receptor displays a 3- to 4-fold higher affinity for activin A than the II receptor.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); Membrane protein, integral; Kinase, protein; EC 2.7.11.30; TKL group; STKR family; Type2 subfamily

Chromosomal Location of Human Ortholog: 3p22

Cellular Component: cytoplasm; integral to plasma membrane; plasma membrane; protein complex; receptor complex

Molecular Function: activin receptor activity, type II; growth factor binding; protein binding; protein serine/threonine kinase activity

Biological Process: activin receptor signaling pathway; anterior/posterior pattern formation; blood vessel remodeling; BMP signaling pathway; lymphangiogenesis; negative regulation of transcription from RNA polymerase II promoter; positive regulation of activin receptor signaling pathway; positive regulation of bone mineralization; positive regulation of osteoblast differentiation; regulation of transcription, DNA-dependent; signal transduction; transmembrane receptor protein serine/threonine kinase signaling pathway

Disease: Heterotaxy, Visceral, 4, Autosomal

Similar Products

Product Notes

The ACVR2B acvr2b (Catalog #AAA6140473) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACVR2B (Activin Receptor Type 2B, Activin Receptor Type IIB, ACTR-IIB) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACVR2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACVR2B acvr2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACVR2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.