Mouse anti-Human ACVR2B Monoclonal Antibody | anti-ACVR2B antibody

ACVR2B (Activin Receptor Type 2B, Activin Receptor Type IIB, ACTR-IIB) (Biotin)

Cat. Num. AAA6140473

• Gene Names: ACVR2B; HTX4; ACTRIIB; ActR-IIB
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACVR2B; Monoclonal Antibody; ACVR2B (Activin Receptor Type 2B; Activin Receptor Type IIB; ACTR-IIB) (Biotin); anti-ACVR2B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C11
• Specificity: Recognizes human ACVR2B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ACVR2B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa21-120 from human ACVR2B (NP_001097) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWANSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of ACVR2B expression in transfected 293T cell line by ACVR2B monoclonal antibody. Lane 1: ACVR2B transfected lysate (57.724kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ACVR2B is ~1ng/ml as a capture antibody.)

Related Product Information for anti-ACVR2B antibody

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. ACVR2B (activin A type IIB receptor)displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.

Product Categories/Family for anti-ACVR2B antibody

Antibodies; Activin Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 116734708
• NCBI GeneID: 93
• NCBI Accession #: NP_001097
• NCBI GenBank Nucleotide #: NM_001106
• UniProt Accession #: Q13705; Q4VAV0
• Molecular Weight: – Da
• NCBI Official Full Name: activin receptor type-2B
• NCBI Official Synonym Full Names: activin A receptor, type IIB
• NCBI Official Symbol: ACVR2B
• NCBI Official Synonym Symbols: HTX4; ACTRIIB; ActR-IIB
• NCBI Protein Information: activin receptor type-2B
• UniProt Protein Name: Activin receptor type-2B
• Protein Family: Activin receptor
• UniProt Gene Name: ACVR2B
• UniProt Synonym Gene Names: ACTR-IIB
• UniProt Entry Name: AVR2B_HUMAN

Uniprot Description

ACVR2B: a tyrosine-kinase like receptor kinase of the STKR family. The holoreceptor receptor is a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. Each is composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic kinase domain. Type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptor kinases are apparently constitutively active. The IIB receptor displays a 3- to 4-fold higher affinity for activin A than the II receptor.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); Membrane protein, integral; Kinase, protein; EC 2.7.11.30; TKL group; STKR family; Type2 subfamily

Chromosomal Location of Human Ortholog: 3p22

Cellular Component: cytoplasm; integral to plasma membrane; plasma membrane; protein complex; receptor complex

Molecular Function: activin receptor activity, type II; growth factor binding; protein binding; protein serine/threonine kinase activity

Biological Process: activin receptor signaling pathway; anterior/posterior pattern formation; blood vessel remodeling; BMP signaling pathway; lymphangiogenesis; negative regulation of transcription from RNA polymerase II promoter; positive regulation of activin receptor signaling pathway; positive regulation of bone mineralization; positive regulation of osteoblast differentiation; regulation of transcription, DNA-dependent; signal transduction; transmembrane receptor protein serine/threonine kinase signaling pathway

Disease: Heterotaxy, Visceral, 4, Autosomal