Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between INHBB and ACVR1C. HeLa cells were stained with INHBB rabbit purified polyclonal 1:1200 and ACVR1C mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Mouse anti-Human ACVR1C Monoclonal Antibody | anti-ACVR1C antibody

ACVR1C (Activin Receptor Type-IC, Activin Receptor Type 1C, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, ALK7) (PE)

Gene Names
ACVR1C; ALK7; ACVRLK7
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACVR1C; Monoclonal Antibody; ACVR1C (Activin Receptor Type-IC; Activin Receptor Type 1C; ACTR-IC; Activin Receptor-like Kinase 7; ALK-7; ALK7) (PE); anti-ACVR1C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E3
Specificity
Recognizes human ACVR1C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ACVR1C antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa23-112 from human ACVR1C (AAH22530) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between INHBB and ACVR1C. HeLa cells were stained with INHBB rabbit purified polyclonal 1:1200 and ACVR1C mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between INHBB and ACVR1C. HeLa cells were stained with INHBB rabbit purified polyclonal 1:1200 and ACVR1C mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-ACVR1C antibody
ACVR1C, a serine/threonine protein kinase, is a type I receptor for the TGFB family of signaling molecules. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors. ACVR1C is a receptor for activin AB, activin B and NODAL. This protein plays a role in cell differentiation, growth arrest and apoptosis.
Product Categories/Family for anti-ACVR1C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
~68 kDa
NCBI Official Full Name
Homo sapiens activin A receptor, type IC, mRNA
NCBI Official Synonym Full Names
activin A receptor, type IC
NCBI Official Symbol
ACVR1C
NCBI Official Synonym Symbols
ALK7; ACVRLK7
NCBI Protein Information
activin receptor type-1C; ALK-7; ACTR-IC; activin receptor type IC; activin receptor-like kinase 7
UniProt Protein Name
Activin receptor type-1C
Protein Family
UniProt Gene Name
ACVR1C
UniProt Synonym Gene Names
ALK7; ACTR-IC; ALK-7
UniProt Entry Name
ACV1C_HUMAN

NCBI Description

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM, Mar 2008]

Uniprot Description

ALK7: Serine/threonine protein kinase which forms a receptor complex on ligand binding. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3. Receptor for activin AB, activin B and NODAL. Plays a role in cell differentiation, growth arrest and apoptosis. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); Membrane protein, integral; Kinase, protein; EC 2.7.11.30; TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 2q24.1

Cellular Component: plasma membrane; activin receptor complex

Molecular Function: transforming growth factor beta receptor activity; activin receptor activity, type I; growth factor binding; metal ion binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: response to dietary excess; sequestering of lipid; apoptotic nuclear changes; response to glucose stimulus; positive regulation of caspase activity; cell differentiation; protein amino acid phosphorylation; response to insulin stimulus; negative regulation of insulin secretion

Research Articles on ACVR1C

Similar Products

Product Notes

The ACVR1C acvr1c (Catalog #AAA6156381) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACVR1C (Activin Receptor Type-IC, Activin Receptor Type 1C, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, ALK7) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACVR1C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACVR1C acvr1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACVR1C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.